KEGG   Sporolactobacillus terrae: C0679_13215Help
Entry
C0679_13215       CDS       T05792                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00020  Citrate cycle (TCA cycle)
stea00620  Pyruvate metabolism
stea01100  Metabolic pathways
stea01110  Biosynthesis of secondary metabolites
stea01120  Microbial metabolism in diverse environments
stea01130  Biosynthesis of antibiotics
stea01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0679_13215
   00620 Pyruvate metabolism
    C0679_13215
Enzymes [BR:stea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     C0679_13215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: QAA26452
UniProt: A0A410DBT5
Position
complement(2736398..2736610)
Genome map
AA seq 70 aa AA seqDB search
MGKTDVILIGASTAVFVMLDVLERCFPDQMKLWQGKIKQMIPSYGIQLADDPVLADKIQT
ETAQTLKLKK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacagatgtgattttaatcggcgcatcgaccgccgttttcgtcatgcttgat
gttcttgagcgatgctttcccgatcagatgaagctttggcaagggaaaatcaagcagatg
attccttcttacggaattcagcttgcggatgatccggttcttgcggataaaatccaaacg
gaaaccgcacaaacactcaaattgaaaaaatga

DBGET integrated database retrieval system