KEGG   Sporomusa termitida: SPTER_37340Help
Entry
SPTER_37340       CDS       T06115                                 

Gene name
fhs_4
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sted  Sporomusa termitida
Pathway
sted00670  One carbon pool by folate
sted01100  Metabolic pathways
sted01120  Microbial metabolism in diverse environments
sted01200  Carbon metabolism
Module
sted_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sted00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPTER_37340 (fhs_4)
Enzymes [BR:sted01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SPTER_37340 (fhs_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS DUF3577
Motif
Other DBs
NCBI-ProteinID: QDR82309
UniProt: A0A517DY71
Position
complement(3904487..3906247)
Genome map
AA seq 586 aa AA seqDB search
MAWDPTVLKDWQIAEAAEGNIPTTAQYQEMMGLQKDEIIPYGKTPKIDFLKVIDRLKDKP
DGKYIEVTAITPTPLGEGKSTTSIGIMEGLGKRGVNVGGALRQPSGGPTMNVKGTAAGGG
NALLIPMTEFSLGLTGDINDIMNAHNLAMVALNARMQHEANYTDAELEKRGLKRLDIDPK
NIEMGWVLDFAAQGLRNILIGLGGKKDGFMMHSKFGIAVGSELMAILAVARDLADMRERF
KHIVVGYNRQGNPVTTGDLEVDGAMTAWMRNTINPTLCATVEGQPCFVHAGPFANIAIGQ
SSIIADRIGLKCFDYHVTESGFAADIGFEKFWNVKCRLSGLKPNVSILVATVRALKMHGG
GPTVVPGRPLPDEYTRENLGLLEKGCENMVHLINMIKKSGVKPVVCINAFYTDTPAEHAL
VKRIAEQAGARAAVSEHWLKGGDGALDLADAVMDACKEEVDFQYLYPLEMPLRQRVERIA
TEVYGADGVDWAPLAEEKAKKFESDPKYADYCTMMVKSHLSLSHEPTWKGVPKGWRLPIR
DVLVYGGAKFLCPMAGAISLMPGTSSDPAYRRIDVDVKTGKVSGLF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatcctacagtattgaaggactggcaaatagccgaagcggcagaggggaat
atcccaactaccgcccagtaccaagagatgatggggctgcaaaaagatgaaataattcct
tatggtaaaacgccgaagattgatttcctgaaggtgatcgaccgtctgaaagataaaccg
gacggcaaatatattgaagtaaccgcgatcacgcccacccccttaggggaaggcaagtca
accacttccatcggcattatggaaggcctgggcaaacgcggtgtgaatgtgggcggcgcc
ctgcgtcagccttccggcgggccgactatgaacgttaaggggactgcggccggcggcggt
aatgccctgttaattccgatgaccgagttctccctgggcctgaccggggacatcaacgac
ataatgaatgcgcataatctggcgatggtcgccttaaatgcccgcatgcagcatgaggcc
aattataccgatgccgagctggaaaaacgcggtctgaagcggctggatattgatccgaaa
aatattgaaatgggctgggtgctggactttgccgcccagggcctgcgtaatatcctcatt
ggcctgggcggcaaaaaagacggctttatgatgcactccaagtttggtatcgccgttggc
tcggaattgatggcgattctggctgtggccagagatctggccgatatgcgggaacggttc
aaacacatcgtggttggctataaccgccagggtaacccggttacgaccggcgacctggaa
gtggacggggccatgaccgcctggatgcgcaataccatcaacccgaccctgtgcgccacc
gtggaagggcagccctgttttgttcatgccggcccgtttgccaacattgcaatcggtcag
tcctcgatcatagcggaccgcatcggcctgaagtgctttgattatcatgttaccgagtcc
ggttttgccgccgatatcggttttgaaaaattctggaatgtaaaatgccgcctgagcggt
ctgaagccaaacgtctcgatcctggtagccactgtacgcgctttgaagatgcatggcggc
ggccccaccgtagtaccagggcggccgttgcctgatgaatacacccgggaaaacctgggc
ctgctggaaaaaggctgcgagaacatggtgcatttgatcaacatgatcaagaagtccggc
gtcaaaccggttgtatgcattaacgccttctacaccgatacgccggccgaacatgccctg
gtcaagagaattgccgagcaggccggcgcccgcgccgcggtctcggagcattggttaaag
ggcggcgacggtgccctggatctggccgatgcggtcatggatgcctgcaaagaagaagtc
gacttccaatacctctacccgttggaaatgccgctgcggcagcgggttgagcggatcgcc
accgaagtctacggcgctgacggcgtggactgggcgccgctggccgaagagaaagccaag
aagtttgagtctgatcctaaatatgccgactactgcacaatgatggttaaatcgcacctg
tccctgtcgcatgaaccaacctggaaaggcgtgcccaaaggctggcggctgccgatcaga
gatgtattggtttatggcggcgccaagttcctctgcccgatggccggcgctatcagcctg
atgccgggcaccagctccgatcctgcctatcgccgcattgatgttgatgttaaaaccggc
aaggtcagcggtttattctaa

DBGET integrated database retrieval system