KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_00145Help
Entry
AXG53_00145       CDS       T04408                                 

Definition
(GenBank) hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00430  Taurine and hypotaurine metabolism
stek00620  Pyruvate metabolism
stek00640  Propanoate metabolism
stek00680  Methane metabolism
stek01100  Metabolic pathways
stek01120  Microbial metabolism in diverse environments
stek01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG53_00145
   00640 Propanoate metabolism
    AXG53_00145
  09102 Energy metabolism
   00680 Methane metabolism
    AXG53_00145
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AXG53_00145
Enzymes [BR:stek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AXG53_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AMJ55219
UniProt: A0A126NE18
Position
33164..34132
Genome map
AA seq 322 aa AA seqDB search
MDAQERLATLLEALSEPWPSPDVVVHRIVHGGDLHDARELDETVLAKLDALVPFAPLHQP
VALAFARAARMRWPHARQGVAFDTDFHASLAPWSRRLPVPEAWDALGIRRYGFHGLAFAS
ALRIVASHDAGILKGRAVFAHLGGGCSVCAVEGGRSRDTTMALTPLGGIPSPTRSGDLDP
GALLYLLRHERLDAQALENGLYRSAGLAGIAGHGDMRVLLTDPGPQAQLAVELFAVRIAQ
SIAAMATAIGGLDHVVFSGGIGHRAPVLRARIVARLAWLGLALAPDVNDAGATRIDRGGG
PSIWNVAIDEERELAESALAWL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcgcaggagcgccttgccaccctgctcgaggcattgtcggagccgtggcccagc
cccgacgtggtggtgcaccgaatcgtacatggcggtgacctgcacgacgcccgcgagctc
gacgaaaccgtgctcgcgaaactggatgcattggtgccgttcgcacccttgcaccagccg
gtagccctcgctttcgcgcgtgccgcgcgcatgcgttggccgcacgcgcgccaaggcgtg
gccttcgacaccgacttccacgcgtcgctcgcgccctggagccggcgcttgcctgtccct
gaagcatgggatgcgctgggcatccgccgctacggtttccatggactcgcctttgcctcc
gcgctccgcatagtggccagccacgacgctggaatcctgaagggccgcgctgtcttcgcg
catctggggggtggctgcagcgtctgcgccgtcgagggcggccgcagccgcgacaccacc
atggcgctcactccgctgggtggaatcccgagccctacccgctccggagatctcgatccc
ggcgcgttgctgtatctgctgaggcatgaacgcctggatgcgcaggcgcttgaaaacggc
ctgtaccgcagtgcaggccttgccggaatcgccggccatggcgacatgcgcgtgttgctg
acggatcccggcccgcaggcccagcttgccgtggagctctttgcagtccggattgcgcag
tccatcgcggccatggccacggcaattggcggtctcgaccatgtcgtcttttccggcggc
atcggccatcgcgcgccggttttgcgggctcgcatcgtcgcgcgactggcctggctcggc
ctggcgctggcacctgacgtcaacgatgctggagccacgcggatcgaccgcgggggcggg
ccgagcatatggaacgtcgcgatcgatgaggagcgcgaactggctgaatcggcactcgcc
tggctgtag

DBGET integrated database retrieval system