KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_02160Help
Entry
AXG53_02160       CDS       T04408                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00270  Cysteine and methionine metabolism
stek00920  Sulfur metabolism
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AXG53_02160
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXG53_02160
Enzymes [BR:stek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AXG53_02160
    2.3.1.46  homoserine O-succinyltransferase
     AXG53_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AMJ55574
UniProt: A0A126NF49
Position
488759..489883
Genome map
AA seq 374 aa AA seqDB search
MTEFIPEGSRFHALSSPFPMKRGGSLVGARVAYETWGSLAADASNAILIVTGLSPDAHAA
SNAANPASGWWEPMLGPGKPIDTDRWFVICVNSLGSCKGSTGPASINPATGQTYRLGFPE
LSIEDVANAAAEVVHALGIKQLACLIGNSMGGMTALAVLLQHPGIARTHINISGSARALP
FSIAIRSLQREAIRLDPAWNNGDYDELHYPESGMRMARKLGVITYRSALEWDGRFGRVRL
DSDQTDEDPFGLEFQVESYLEGHARRFVRHFDPNSYLYLGRSMDWFDLAEYANGDVLAGL
AKIRIERALAIGANTDILFPVEQQQQIADGLRAGGADAQFLGMDSPQGHDAFLVDYTRFG
PAVSQFLQTLPTAG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcattcccgagggcagccgcttccacgcgctgtcgtccccgttcccgatg
aagcgcggtggcagcctggtcggcgcccgcgtcgcttacgaaacctggggcagcctggcc
gccgatgccagcaatgcaatcctgatcgtcaccggcctgtcgcccgatgcgcacgccgcc
agcaacgccgccaatcccgcctctggctggtgggaacccatgctcggcccgggcaaaccc
atcgataccgatcgctggttcgtcatctgtgtcaactcgctgggcagctgcaagggctcc
actggcccggcctcgatcaatcccgccaccggccagacctaccgcctgggtttccccgag
ttgtccatcgaggacgtggccaatgccgccgccgaagtcgtgcacgcactgggcatcaaa
cagctggcctgcctgatcggcaactcgatgggcggcatgaccgccctggcggtgctgctg
cagcacccgggcattgcccgcacccacatcaatatttccggcagcgcccgtgccctgccg
ttctccatcgccatccgatcgctgcagcgcgaagccatccgccttgatccggcatggaac
aacggcgactacgatgagttgcattacccggaatcgggcatgcgcatggcacgcaagctc
ggcgtcatcacctatcgctcggcgctggaatgggatggccgcttcggccgcgtacggctg
gattcggaccagaccgatgaagatccgttcggcctggaattccaggtggaaagttatctg
gaaggccatgcacgccggttcgtgcgccacttcgatcccaacagctatctctacctcggc
cgctccatggattggttcgacctggccgaatacgcaaacggcgatgtactcgccgggttg
gcgaaaatccgtattgaacgcgcactcgccatcggcgccaataccgacatcctgttcccg
gtggaacaacaacagcagatcgccgacggcctgcgtgccggcggtgccgatgcacagttc
cttggcatggattcaccgcagggccatgacgcgttcctggtcgattacacgcgcttcggc
ccggctgtgtcgcagttcctgcagacactaccgacagccgggtag

DBGET integrated database retrieval system