KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_04130Help
Entry
AXG53_04130       CDS       T04408                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00640  Propanoate metabolism
stek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AXG53_04130
Enzymes [BR:stek01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     AXG53_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AMJ55920
UniProt: A0A126NG33
Position
complement(934464..937079)
Genome map
AA seq 871 aa AA seqDB search
MNTDYRKHLAGSTLDYFDARAAVDAIQPGAYATLPYTSRVLAENLVRRCNPATLSDSLKQ
LIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVPVQLIVDH
SLAVECGGYDPDAFAKNRAIEDRRNEDRFHFIDWTKLAFENVDVIPPGNGIMHQINLEKM
SPVIYQQGGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIIGV
RLTGKPQPNITATDVVLAITEFLRKERVVGAWLEFFGEGAAALTIGDRATISNMCPEYGA
TAAMFYIDQQTIDYLRLTGREEAQIALVENYAKTTGLWADALETAKYERVLEFDLSSVVR
NMAGPSNPHKRLPVSDLAERGIADEAKLESGKVEEAEGLMPDGAVIIAAITSCTNTSNPR
NVIAAALLARNANARGLTRKPWVKSSLAPGSKAVQLYLEEAGLLPDLEKLGFGIVAFACT
TCNGMSGALDPAIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAG
TVRFDIEKDVLGVDAEGKEVRLKDIWPSDAEIDAVVKASVKPEQFRKVYNPMFNIRVEHG
EKVSPLYNWRPQSTYIRRPPYWEGALAGERTLRGMRALAVLPDNITTDHLSPSNAILRSS
AAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRNEDGSVKQGSLARVE
PEGKVMRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIAAEGFERIH
RTNLIGMGVLPLEFKPGTNRNTLGIDGTETYDVQGLRTPGTDLTLVITRRNGEVLKVPMT
CRLDSDEEVAIYEAGGVLQRFAQDFLEGAVA
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgattaccgcaaacacctcgccggcagcacgctcgattacttcgacgcacgc
gccgcagtcgatgccatccagcccggcgcctacgccacgctgccctatacctcgcgcgtg
ctggccgaaaacctggtgcgccgctgcaaccccgccacgctgagcgattcgctcaagcag
ctgatcgaacgcaagcgcgacctcgacttcccctggttcccggcacgcgtggtctgccac
gacatcctcggtcagaccgcgctggtcgacctggcgggcctgcgtgatgccatcgctgaa
aagggcggtgacccggccaaggtcaatccggtggtgccggtgcagctgatcgtcgatcac
tcgctggcggtggaatgcggtggctacgatccggatgcgttcgccaagaaccgcgccatc
gaagaccgccgcaacgaagaccgcttccacttcatcgactggaccaagctggccttcgaa
aacgtcgatgttattccgccgggcaacggcatcatgcaccagatcaatctggagaagatg
tcgccggtgatctaccagcagggtggggtggccttcccggatacctgcgtgggcaccgac
agccacaccccgcatgtggacgcgctgggcgtgatcgccatcggcgtgggcggcctggaa
gccgagaacgtgatgctgggccgcgcctcttggatgcgcctgcccgacatcatcggcgtc
aggcttaccggcaagccgcagccgaacatcaccgccaccgacgtggtgctggcaatcacc
gagttcctgcgcaaggaacgcgtggtcggcgcctggctggagttcttcggtgaaggcgct
gcagcactgaccatcggcgaccgcgccaccatttccaatatgtgcccggaatacggtgcg
actgcggcgatgttctacatcgaccagcagaccatcgattacctgcgcctgaccggccgc
gaagaagcacagatcgccttggtcgagaactacgccaaaaccactggcctgtgggccgac
gcattggaaacggcgaagtacgagcgcgtactggagttcgatctgtccagcgtggtgcgc
aacatggccggccccagcaacccgcacaagcgcctgccggtgtcggatctggccgagcgc
ggcattgccgatgaagccaagctggaaagtggcaaggtcgaggaagccgaaggcctgatg
ccggatggtgcggtgatcatcgctgccatcaccagctgcaccaatacctccaacccgcgc
aacgtgattgccgccgccttgctggcacgcaacgccaatgcgcgcgggctgacccgcaag
ccgtgggtcaaatcgtcgctggcgccgggctccaaggcggtgcagttgtacctggaagaa
gccggcctgctgccggatctggaaaagctgggcttcggcatcgttgcctttgcctgcact
acctgcaacggcatgagtggtgcgctggatcctgcgatccagcaggaaatcatcgaccgc
gatctgtacgcaaccgccgtgctgtccggcaaccgcaacttcgatggccgcatccatccg
tatgcgaagcaggccttcctggcctcgccgccgctggtgatcgcctatgccattgccggc
accgtgcgtttcgacatcgagaaggatgtgctgggtgtggatgccgagggcaaggaagtg
cgcctgaaggacatctggccgagcgatgccgagatcgacgcggtggtgaaggcctcggtc
aagccggagcagttccgcaaggtctacaacccgatgttcaacatccgcgtcgagcacggt
gaaaaggtcagcccgttgtacaactggcgcccgcagagcacctatatccgccgtccgccg
tattgggagggtgcattggccggtgagcgcacgctgcgcggcatgcgcgcattggccgtg
ctgccggacaacatcaccaccgaccatctgtcgccatccaatgccatcctgcgttccagc
gcggccggtgagtacctggccaagatgggcctgccggaagaggacttcaattcctacgcg
acccaccgcggtgaccacctgaccgcgcagcgcgccaccttcgccaaccccaagctcttc
aacgagatggtgcgcaacgaagacggcagcgtgaagcagggttcgctggcgcgcgtggag
ccggaaggcaaggtgatgcgcatgtgggaggcaattgaaacctacatggaacgcaagcag
ccgctgatcatcattgccggcgccgactacggccagggcagctcgcgcgactgggccgcc
aagggcgtacggctggccggcgtggaggcgattgcggccgaaggcttcgagcgcatccac
cgcaccaacctgatcggcatgggggtgctgccgctggagttcaagccgggcaccaaccgc
aacacgctgggcattgacggtaccgaaacctacgacgtgcagggcctgcgcacgccgggc
acggacctgaccctggtcatcacccgtcgcaacggtgaagtgctgaaggtgccgatgacc
tgccgtctggattcggacgaggaagtagcaatctacgaggccggcggcgtgctgcagcgt
ttcgcgcaggattttttggagggcgcggttgcctga

DBGET integrated database retrieval system