KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_09965Help
Entry
AXG53_09965       CDS       T04408                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00230  Purine metabolism
stek00240  Pyrimidine metabolism
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01130  Biosynthesis of antibiotics
Module
stek_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
stek_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
stek_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AXG53_09965
   00240 Pyrimidine metabolism
    AXG53_09965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:stek04131]
    AXG53_09965
Enzymes [BR:stek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AXG53_09965
Membrane trafficking [BR:stek04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AXG53_09965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AMJ56934
UniProt: A0A126NJ31
Position
complement(2365758..2366183)
Genome map
AA seq 141 aa AA seqDB search
MALERTLSIIKPDAVAKNVIGEIYARFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF
NALVEFMISGPVMIQALEGENAVLAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD
SVENAANEVAYFFAATEVVSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggagcgcactctttccatcatcaagcccgacgccgttgccaagaacgtgatc
ggcgaaatctacgcccgcttcgaaaaggccggcctgaaggttgtggctgccaagtacaag
cagctgtcgcgccgtgaagccgaaggcttctatgcggtgcaccgcgagcgtccgttcttc
aacgcgctggtcgagttcatgatctccggcccggtgatgatccaggccctggaaggcgag
aacgccgtgctggcccaccgcgacctgctgggtgccaccaacccgaaggatgctgctccg
ggtaccatccgcgccgatttcgctgattcgatcgacgccaatgccgcccacggttcggat
tcggtcgagaacgcagccaacgaagtggcttacttctttgctgccaccgaagtggtttcg
cgttaa

DBGET integrated database retrieval system