KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_11470Help
Entry
AXG53_11470       CDS       T04408                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00280  Valine, leucine and isoleucine degradation
stek00310  Lysine degradation
stek00362  Benzoate degradation
stek00380  Tryptophan metabolism
stek00620  Pyruvate metabolism
stek00630  Glyoxylate and dicarboxylate metabolism
stek00640  Propanoate metabolism
stek00650  Butanoate metabolism
stek00900  Terpenoid backbone biosynthesis
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01120  Microbial metabolism in diverse environments
stek01130  Biosynthesis of antibiotics
stek01200  Carbon metabolism
stek01212  Fatty acid metabolism
stek02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG53_11470
   00630 Glyoxylate and dicarboxylate metabolism
    AXG53_11470
   00640 Propanoate metabolism
    AXG53_11470
   00650 Butanoate metabolism
    AXG53_11470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXG53_11470
   00072 Synthesis and degradation of ketone bodies
    AXG53_11470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXG53_11470
   00310 Lysine degradation
    AXG53_11470
   00380 Tryptophan metabolism
    AXG53_11470
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXG53_11470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXG53_11470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXG53_11470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stek04147]
    AXG53_11470
Enzymes [BR:stek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXG53_11470
Exosome [BR:stek04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXG53_11470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMJ57190
UniProt: A0A126NJM4
Position
2701923..2703098
Genome map
AA seq 391 aa AA seqDB search
MSDIVIAAAKRTAIGSFLGQFNGVPTPTLGAAAISAAMQQSGIAASDVSEVIMGCVLPAN
LGQAPARQAALAAGLPTNTGATTLNKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHMLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFAEATVAKFGFTREEQDAYAI
ESVTRAQAAVANGAFADEIVAVKVATRKGEVEFAQDEQPGKSDISKIPTLRPAFKKDGSV
TAASSSSISDGAAALVLLSADDAAKRGVQPLARIAAHATFSQEPEWFTTAPIGAITKVLE
KAGWNIADVDLFEINEAFAVVAMAPIRELGIPHAKINVNGGACALGHPIGASGARLVVTL
VNALRTRGLKRGIASLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacatcgtcatcgccgccgccaagcgtaccgccattggctccttccttggccag
ttcaacggcgtccccaccccgaccctcggtgcagctgcgatcagcgcggccatgcagcag
tccggcattgctgccagcgacgtgtccgaagtgatcatgggctgcgtgctgcccgccaac
ctcggccaggcaccggcccgccaggccgcactggccgccggcctgccgaccaacaccggc
gccaccaccctcaacaaggtctgcggctcgggcatgaaagccatcatgctgggccacgac
ctgatcaaggccggctcggccagcatcgtggtcgccggcggcatggagtccatgtccaac
gccccgcacatgctgcccaactcgcgcaccggcaaccgctacggcaatttccaggcggtg
gaccacatggcgtgggacggcctgaccaacccgtacgacggccaggccatgggcgtgttt
gccgaggctaccgtggccaagttcggcttcacccgcgaagagcaggatgcctacgccatc
gagtcggtcacccgtgcccaggccgccgtggccaatggtgcgttcgccgacgaaatcgtt
gcggtcaaggttgccacccgcaagggcgaggtggagttcgcccaggacgagcagccgggc
aagtcggacatcagtaaaattcctacgctacgcccggccttcaagaaggacggcagcgtc
accgccgccagctcttcgagcatttccgacggtgctgccgcgctggtgttgctgtctgcc
gacgatgccgccaagcgcggcgtgcagccgctggcgcgcatcgccgcacacgccaccttc
tcgcaggaaccggagtggttcactaccgccccgatcggcgcgatcaccaaggtcctggaa
aaagccggctggaacatcgccgacgttgacctgttcgaaatcaacgaagccttcgccgtg
gtagccatggcaccgatccgcgaactgggcatcccgcatgccaagatcaacgtcaatgga
ggggcctgcgcattgggtcatccgatcggtgcttcgggtgcccgcttggtggttacgctg
gtaaatgcattgcgcacacgtggcctcaagcgtggcattgcatcgctttgcatcggtggt
ggcgaagcaaccgctatcgccattgaattgatttga

DBGET integrated database retrieval system