KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_17785Help
Entry
AXG53_17785       CDS       T04408                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00010  Glycolysis / Gluconeogenesis
stek00071  Fatty acid degradation
stek00350  Tyrosine metabolism
stek00625  Chloroalkane and chloroalkene degradation
stek00626  Naphthalene degradation
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01120  Microbial metabolism in diverse environments
stek01130  Biosynthesis of antibiotics
stek01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXG53_17785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXG53_17785
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AXG53_17785
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXG53_17785
   00626 Naphthalene degradation
    AXG53_17785
Enzymes [BR:stek01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXG53_17785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMJ58275
UniProt: A0A126NMT8
Position
4161445..4162473
Genome map
AA seq 342 aa AA seqDB search
MDKTMKAAVVREFGKPLVIEEVTVPRPAAGDILVKIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGEGVTHIKEGDRVGIPWLYSACGYCEHCLGGWETLCEAQQNSGYSV
NGGFAEYALANANYVGHLPKEVGFVEIAPILCAGVTVYKGLKVTDTKPGDWVAISGIGGL
GHMAVQYAKAMGLNVAAVDIDDGKLALAKRLGASITVNARNTDPAAFLKKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGDFPLDIFGMVLNGITVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDKLENINDVFKRMHEGAIEGRVVLDFNA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacgatgaaagccgccgtggtccgcgaattcggcaagccgctggtgatcgaa
gaagtcaccgtgccgcgcccggccgcaggcgacatcctggtcaagatcgaggcctgtggc
gtctgccacaccgacctgcacgccgccgaaggcgactggccggtaaagcccaatcccccc
ttcattcccggccacgagggcgtaggccatgtggtcgcggtgggcgagggcgtcacccac
atcaaggaaggcgaccgcgtcggcattccatggctgtactcggcctgcggttactgcgag
cactgcctgggcggctgggaaaccctgtgcgaggcgcagcagaacagcggctattcggtg
aacggtgggttcgccgagtacgccctggccaacgccaactacgtcggccacctgcccaag
gaagtgggcttcgtcgagatcgcacctatcctctgcgccggtgtcaccgtctacaagggc
ctgaaggtcaccgacactaagcccggtgactgggtggcgatttccggcatcggtggcctc
ggccacatggcggtgcagtacgccaaggcgatgggcctgaacgtggccgcggtggatatc
gatgacggcaagctggcgctggccaagcgcctgggtgccagcatcaccgtcaacgcccgc
aacaccgatccggcggccttcctgaagaaggaaatcggtggcgcgcatggtgccctggtc
accgcggtctcgccgaaggcctttgaacaggccttgggcatggtgcggcgtggcggcacg
gtgtccttgaacggcctgccgccgggcgacttcccgctggacatcttcggcatggtgctc
aacggcatcaccgtacgcggctcgatcgtcggcacccgcctggacctgcaggaatcgctg
cagttcgccgccgaaggcaaggtcgccgccacggtgagcaccgacaagctggagaacatc
aacgacgtcttcaagcgcatgcacgaaggcgcgattgaaggccgtgtggtgttggacttc
aacgcctga

DBGET integrated database retrieval system