KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_18610Help
Entry
AXG53_18610       CDS       T04408                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00071  Fatty acid degradation
stek00072  Synthesis and degradation of ketone bodies
stek00280  Valine, leucine and isoleucine degradation
stek00310  Lysine degradation
stek00362  Benzoate degradation
stek00380  Tryptophan metabolism
stek00620  Pyruvate metabolism
stek00630  Glyoxylate and dicarboxylate metabolism
stek00640  Propanoate metabolism
stek00650  Butanoate metabolism
stek00900  Terpenoid backbone biosynthesis
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01120  Microbial metabolism in diverse environments
stek01130  Biosynthesis of antibiotics
stek01200  Carbon metabolism
stek01212  Fatty acid metabolism
stek02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stek00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG53_18610
   00630 Glyoxylate and dicarboxylate metabolism
    AXG53_18610
   00640 Propanoate metabolism
    AXG53_18610
   00650 Butanoate metabolism
    AXG53_18610
  Lipid metabolism
   00071 Fatty acid degradation
    AXG53_18610
   00072 Synthesis and degradation of ketone bodies
    AXG53_18610
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXG53_18610
   00310 Lysine degradation
    AXG53_18610
   00380 Tryptophan metabolism
    AXG53_18610
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXG53_18610
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXG53_18610
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AXG53_18610
Enzymes [BR:stek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXG53_18610
Exosome [BR:stek04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXG53_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMJ58403
UniProt: A0A126NNG9
Position
4372628..4373908
Genome map
AA seq 426 aa AA seqDB search
MPSARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHPSDWNLGREAALSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDT
TSDVPIVYGKKLRARLLAANRAKSTGDKIRTLLKGFKFSELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVSSHRKLAAAYERGFFNDLIAPFRGVERDNILRPDTSLEKL
ATLKPAFDKSSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPLAYLRDSQVAAVDF
VHGEGLLMAPTIAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEEYCRNRLGL
DAALGRIDPDKINPLGSSLATGHPFAATGARIIGTVAKELAARGGGRALVSICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgctcgtccagtcgccattctcggtggcgtccgcatcccgttctgccgtcag
aacactgcttattcggatgttggcaatcttggtatgtcagtccgtacgctcggtgcgctt
gttgaacggttcggcctgcacggccagcagctgggcgaagtggcgatgggcgcggtgatc
aagcaccccagcgactggaacctgggccgcgaggccgcgctgtcgtccgggctgtcgccg
ctgaccccgggcatcaccctgcaacgtgcctgtggtacttcactggacagcatcatcacc
gtggccaacaagatcgccctggggcagatcgagtcgggcatcggcggtggctcggatacc
acctccgacgtgccgatcgtctatggcaagaagctgcgggcgcgcctgctggccgccaac
cgtgccaagagcaccggtgacaagatccgtaccctgctcaagggcttcaagttctccgag
ctcaagcccgagttcccaggcgtcgccgagccgcgcaccggcaagagcatgggcgaccac
tgcgaggacatggccaaggaatggaacatctcgcgcgattcccaggatgagtgggcggtg
tcctcgcacaggaagctggctgctgcttacgagcgcggcttcttcaacgacctgatcgcg
ccgttccgtggcgtcgagcgcgacaacatcctgcgtccggacacctcgctggaaaagctg
gccaccttgaagccggccttcgacaagagctccggccgtggcaccttgaccgccgccaac
tccaccccgctgaccgacggtgccgctgccgtgctgctggccagcgaggaatgggcgcgc
gcccacggccacgagccgttggcctatctgcgcgattcgcaggtggcggcggtggacttc
gtgcatggtgaaggcctgctgatggcaccgaccatcgccgtgccggagatgctcaagcgc
aacggtctgaccctgcaggatttcgacatctacgaaatccatgaagccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggagtactgccgcaaccgcctgggtctg
gatgccgcattgggccgcatcgatccggacaagatcaacccgctgggttcgtcgctggct
actggccacccgttcgcagcaaccggcgcccgcatcatcggcaccgttgccaaggaactg
gccgcacgcggcggcggccgtgcgctggtgtcgatctgcaccgccgggggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system