KEGG   Stenotrophomonas sp. MYb57: CLM74_02600Help
Entry
CLM74_02600       CDS       T05384                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00350  Tyrosine metabolism
stem00643  Styrene degradation
stem01100  Metabolic pathways
stem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLM74_02600 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    CLM74_02600 (maiA)
Enzymes [BR:stem01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CLM74_02600 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AVJ31746
Position
569306..569974
Genome map
AA seq 222 aa AA seqDB search
MEIPVDDGIVLYTYWRSSAAYRVRIGLALKGLAFEARPVHLVREGGEQHHDAYRGLNPQQ
LVPTLLHDGHVLTQSLAILEYLEERFPQVPLLPADAAGRARVRALAQLVACDIHPINNLR
VMQYLERDLQLPADARTRWTLHWMAEGFAAMETMLANSADTGTFCHGDRPGLADICLLPQ
LYNAHRFGLDLAEYPTLRRIEAACQQLDAFIAARPENQVDAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggagattccggtcgacgacggcatcgtgctgtacacctactggcgatccagcgccgcc
taccgcgtgcgcatcggcctggccttgaaaggcctggccttcgaagcacgaccggtgcat
ctggtgcgcgagggcggcgagcagcaccatgacgcctatcgcgggctcaacccgcagcag
ctggtgcccacgctgctgcatgacggccacgtgctgacccagtcgctggcgatcctggag
tatctggaagagcggttcccgcaggtgccgctgctgccggccgacgccgctggccgcgca
cgggtgcgggcactggcgcagctggtggcctgcgacatccacccgatcaacaacctgcgg
gtgatgcagtacctcgagcgcgatctgcagttgccggccgatgcacgcacgcggtggacc
ctgcactggatggccgagggctttgccgcaatggaaacgatgctggccaacagcgctgac
accggcacgttctgccacggtgaccgtccgggcctggccgacatctgcctgttgccgcag
ctgtacaacgcccatcgcttcggcctggacctggcggaataccccacactgcgccgcatt
gaagcggcctgccagcagctggatgccttcatcgctgcacgccccgaaaaccaggtcgac
gccgcctga

DBGET integrated database retrieval system