KEGG   Stenotrophomonas sp. MYb57: CLM74_21135Help
Entry
CLM74_21135       CDS       T05384                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:stem00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CLM74_21135 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:stem03400]
    CLM74_21135 (recD)
Enzymes [BR:stem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLM74_21135 (recD)
DNA repair and recombination proteins [BR:stem03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CLM74_21135 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 UvrD_C UvrD-helicase SH3_13 DUF2075 AAA_28 Mg_chelatase NACHT NTPase_1 T2SSE ATPase Phageshock_PspD Herpes_Helicase FtsK_SpoIIIE SRP54 AAA_29 AAA_16
Motif
Other DBs
NCBI-ProteinID: AVJ35111
Position
complement(4654263..4656143)
Genome map
AA seq 626 aa AA seqDB search
MNLLRDLHRSGQLRTLDHALAISLKRLREDTPDDVALAAALASLAVAQGHAGFDPRQPQR
VIDGIPAWPEPAQWLAQLQASPWVATPQDANAAAAEAPLVLENGLLYLRRYREYERQLAV
GLQRIGRHPLPAPDMAAVAPLFARLFPHAATGEDHQARAAGVTLRHPLALVTGGPGTGKT
TTIARLLLLLAAQAQHQGLPVPKVALAAPTGRAAERMAESLRLAVQRLQEQGLDPALCTA
LPSTGTTLHRLLGVIPDSPRFRHHADNPLPVDVVVVDEASMIDLPLMAKLVDAIASGTRL
ILLGDPDQLPSVEAGDVLSAILRASGDGIGTRADDAQALHGLLAAATLQPQAPPRAFAGR
RVQLQRGYRQSDALDLAPLAQAVRGGDSGTALRLLRSGGLAGVRFHEGEADPLRGQREHL
LDHWRALADAVDPAQALQQAGRLRVLTALREGPQGARGLNSRIEQLLAGNTPGYFQGRLL
LITENSYRHRLFNGDIGICLRDGSGAMVAWFPGETADQPRAFHPAALPAHESAFAMTVHK
AQGSEFDEVWLQLPRQDSRVLSRELVYTGLTRARQRLQVAGSAEVLEAALKRHASRLGGL
AWRLGAEEVTEEPARGEEPTVQGTLF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctgcgcgatctgcatcgcagtggccagctgcgcaccctggaccacgccctg
gccatcagcctcaagcgcctgcgcgaagacacgccggacgacgtggcactggccgccgca
ctggcctcgctggccgtggcgcaggggcacgctggcttcgatccgcgccagccccagcgc
gtgatcgatggcattccggcatggcccgaacctgcgcagtggctggcgcagctgcaggcc
tcaccctgggtggcgaccccgcaggatgccaacgccgccgccgcggaagcgccgctggtg
ctcgagaacggtctgctgtacctgcgccgctaccgcgaatacgagcggcagttggctgtc
ggcctgcaacgcatcggccgccatccgctgcctgcaccggacatggccgccgtggcgccc
ctgttcgcgcgtctgttcccgcacgccgcaacgggtgaggaccaccaggcccgtgcggct
ggcgtaaccctgcgccacccgctggccctggtcaccggtgggcccggtaccggcaagacc
accaccatcgcgcgcctgctgctgctgttggcggcacaggcgcagcaccagggcctgccc
gtgccgaaggtggcgttggccgcacccaccggccgcgctgccgagcgcatggccgaaagc
ctgcgcctggccgtacagcggctgcaggagcaggggctggacccggcgctgtgcaccgcg
ctgcccagcacaggcaccaccctgcatcgcctgctcggggtgattcccgattcaccgcgc
ttccgccatcacgccgacaacccgttgccggtggacgtggtggtggtcgacgaagcttcg
atgatcgacctgccgctgatggccaagctggtcgacgcgatcgccagcggtacccgcctg
atcctgctcggcgatcccgaccagttgccgtcagtggaagccggtgatgtgctcagcgcc
atcctgcgcgccagcggcgatggcatcggcacccgtgccgacgatgcgcaggcgctgcat
ggactgctggcagcggccacgctgcagccgcaggcaccgccgcgcgcgttcgcaggtcgc
cgcgtgcagttgcagcgtggctaccggcagagtgatgcgctggacctggcgccgctggcg
caggccgtgcgtggcggtgacagtggtaccgccctgcgcctgctgcgcagtggcgggctg
gctggtgtccgcttccatgaaggcgaggcggacccgttgcgtggccagcgcgagcatctg
ctcgaccactggcgcgcactggccgacgcagtggacccggcgcaggcactgcagcaggcc
ggccgcctgcgcgtgttgaccgcactgcgcgaaggcccgcagggcgcgcgtggcctcaac
agccgtattgaacagctgctggctggcaacaccccgggctacttccagggccggctgctg
ctgatcaccgaaaacagctaccgccaccgcctgttcaacggcgatatcggcatctgcctg
cgcgatggcagcggtgcgatggtggcctggttccccggcgagaccgccgaccagccgcgc
gccttccacccggcagccttgcccgcacacgagagcgcgttcgcgatgaccgtgcacaag
gcgcagggttcggagttcgatgaagtgtggttgcagctgccaaggcaggacagccgcgtg
ttgtcgcgcgaactggtctacaccggcctgacccgcgcccgccagcgcctgcaggtggcc
ggcagcgccgaggtgctggaggcggcattgaaacgacatgccagccgccttggtgggttg
gcgtggcgactgggtgcggaagaggtgaccgaggaaccggcgcgcggtgaagaacccacc
gtgcaaggcacgttgttctaa

DBGET integrated database retrieval system