KEGG   Stenotrophomonas sp. MYb57: CLM74_21180Help
Entry
CLM74_21180       CDS       T05384                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00480  Glutathione metabolism
stem00590  Arachidonic acid metabolism
stem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CLM74_21180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CLM74_21180
Enzymes [BR:stem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CLM74_21180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVJ35408
Position
complement(4667533..4668078)
Genome map
AA seq 181 aa AA seqDB search
MSTLIQDISLTTIDGQPSSLADYQGKVLLLVNVASKCGLTPQYEGLQALYAEKHAQGLEV
LGFPANNFLGQEPGSEAEIQQFCQLTYDVSFPMFAKISVAGEDTHPLYQQLTAAQPQAIG
EGPLRERLASKEIPIHPAPAVLWNFEKFLVGRDGKVIARFAPDVAADDARLREAVEAALA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccttgatccaggatatttccctcaccaccatcgacggccagccgtcctctctt
gccgactaccagggcaaggtgctgctgctggtcaacgtggcgtccaagtgcggcctgacc
ccgcagtacgaaggcctgcaggcgctgtatgcggaaaagcacgcgcaggggctggaagta
ctgggcttcccggccaacaacttcctcggccaggagccgggcagcgaggcggagatccag
cagttctgccagctgacctacgatgtgagcttcccgatgttcgccaagatcagcgtggcc
ggtgaagacacccacccgctgtaccagcagctgactgccgcgcagccgcaggcgatcggc
gaaggcccgctgcgcgagcgcctggccagcaaggagattccgatccacccggcaccggcg
gtgctgtggaacttcgagaagttcctggttggccgcgatggcaaggtcatcgcccgcttt
gccccggacgttgccgccgatgacgcgcgcctgcgcgaagcggtcgaggcggcactggcg
gcctga

DBGET integrated database retrieval system