KEGG   Stenotrophomonas sp. WZN-1: CCR98_02020Help
Entry
CCR98_02020       CDS       T04963                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00020  Citrate cycle (TCA cycle)
sten00620  Pyruvate metabolism
sten00650  Butanoate metabolism
sten01100  Metabolic pathways
sten01110  Biosynthesis of secondary metabolites
sten01120  Microbial metabolism in diverse environments
sten01130  Biosynthesis of antibiotics
sten01200  Carbon metabolism
Module
sten_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sten_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCR98_02020
   00620 Pyruvate metabolism
    CCR98_02020
   00650 Butanoate metabolism
    CCR98_02020
Enzymes [BR:sten01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CCR98_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: ARZ73004
UniProt: A0A1Z2LFE4
Position
complement(446372..447886)
Genome map
AA seq 504 aa AA seqDB search
MSVDRIANARLRDRVVSAEAAAALIQPGETVAMSGFTGSGYPKAVPVELARRIEAVHAQG
QPFQIKLMTGASTAPELDGALAKADGIAMRMPFQSDPDARNRINEGKLDYIDIHLSHVAQ
HVWFGFYGEIDTAVIEVSAIREDGSLVPSTSVGNNKTWLDLAKKVIVEVNEWQPAGVDGM
HDIYYGTALPPHRKPIPLVNANDRIGDTALRCDPDKIVAVVRTNGPDRNSPFSPIDATSE
QIASHLIEFLKHEVKKGRLPPNLLPLQSGVGNIPNAVLAGLAKSGFRDLAAFTEVIQDGM
LDLLRDGVLSYASCTGFALSPQANETFKEHIDFYRERIIMRTQEISNHPELVRRLGCIGM
NGMIEVDIYGNVNSTHVMGTRIMNGIGGSGDFARNGFLSAFLSPSTAKNGTISAIVPMAS
HVDHTEHDVSVIVTEQGLADLRGLTPRKRAQVLIDNCAHPDFRPQLQDYFDRASRESYGK
HTPHLLPEALSWHQRWLDTGTMKG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgatcgcatcgccaacgcgcgtctccgtgaccgcgtggtctccgccgaggcc
gcagccgcgctgatccagcccggtgaaaccgtggccatgagcggctttaccggctccggg
tatcccaaggccgttcccgtggaactggcgcgccgcatcgaagcggtgcacgcccagggc
cagcccttccagatcaagctgatgaccggcgcctccaccgcgccggagcttgatggcgcg
ctggccaaggccgatggcatcgccatgcgcatgccgttccagagcgacccggatgcgcgc
aaccgcatcaacgagggcaagctggattacatcgacatccacctcagccacgtggcccag
cacgtgtggtttggcttctacggcgagatcgataccgccgtgatcgaagtctcggccatc
cgcgaggatggctcgctggtgccctccacctcggtgggcaacaacaagacctggctggac
ctggcgaagaaggtgatcgtcgaggtcaacgaatggcagccggccggcgtcgacggcatg
catgacatctactacggcacggcgctgccgccgcaccgcaagccgattccgctggtgaac
gccaacgaccgcatcggcgacaccgcgctgcgctgcgacccggacaagatcgtggccgtg
gtgcgcaccaacggcccggaccgcaacagcccgttcagcccgatcgatgcgaccagcgag
cagatcgcctcgcacctgatcgagttcctcaagcacgaggtgaagaagggccgcctgccg
ccgaacctgctgccgctgcaatcgggcgtgggcaacatcccgaacgcggtgctggccggc
ctggccaagagcggtttccgcgacctggccgcgttcaccgaggtgatccaggacggcatg
ctcgacctgctgcgcgacggcgtgctgagctacgcctcgtgcaccggcttcgcactgagc
ccgcaggccaacgagacgttcaaggaacacatcgatttctaccgcgaacgcatcatcatg
cgcacgcaggaaatctccaaccatccggaactggtgcgccgccttggctgcatcggcatg
aacggcatgatcgaggtggacatctacggcaacgtcaattcgacgcacgtgatgggcacg
cggatcatgaacggtattggcggttccggtgacttcgcccgcaacggtttcctgtcggcg
ttcctcagcccgtccaccgcgaagaacggcaccatctcggcgatcgtgccgatggccagc
catgtcgaccacaccgaacacgacgtgtcggtgatcgtgaccgagcagggcctggctgat
ctgcgtggcctgaccccgcgcaagcgcgcgcaggtgctgatcgacaactgcgcgcacccg
gatttccgtccgcagctgcaggactacttcgaccgtgccagccgcgagagctacggcaag
cacaccccgcacctgctgccggaagcgctgtcgtggcaccagcgctggctggataccggc
acgatgaagggctga

DBGET integrated database retrieval system