KEGG   Stenotrophomonas sp. WZN-1: CCR98_06580Help
Entry
CCR98_06580       CDS       T04963                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00010  Glycolysis / Gluconeogenesis
sten01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCR98_06580
Enzymes [BR:sten01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     CCR98_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: ARZ73852
UniProt: A0A1Z2LHU1
Position
1418369..1419574
Genome map
AA seq 401 aa AA seqDB search
MIALLLALSLATTAATAAPDPMQGDQLEQVVLLSRHNLRAPVVASGALANATPERWPGWD
VASGELTTKGGVLEVYMGRYIGQWLRQAQLLPPSDCPQPGDFHAHANSLQRTQATAQFFV
AGAFPGCHVAVEQRMPLGTMDPLFNPVIHRDDAAFRARAVSAMQQALAATDLAPALSVVE
AITRYPQSAACSAHSDCRLALTDTSFSAAPGNEPRVSGSLALASGLVDALLMEHYQGSGI
PREGWGRLNTEVQWQALAQIRNRYQDILFGTPEVARDVAGPLLARVDALLEDPASPKVSL
LVGHDSNIGSVLAALGITDYTLPGQYEKTPIGGLLQFERWRDHGAGEVRYRLVYVYPTRE
QLRGSIPLTDAQPPGRVELVLPGCGQSGCSEAQFENLLHSP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgctgctgttggcactcagcctggcgaccacggccgcaactgcggcgccggac
cccatgcaaggcgaccagctcgagcaggtggtcctgctcagccgccacaacctgcgcgcg
ccggtggtggcatcgggcgcgctggccaatgccacgccagagcgctggccaggctgggac
gtcgcctcaggcgagctgaccaccaagggtggcgtgctggaggtctacatgggccgctac
atcggccagtggctgcgccaggcacagctgctgccgccgtcggattgcccgcagccgggt
gacttccacgctcacgccaacagcctgcagcgcacccaggccaccgcgcagttcttcgtt
gctggtgccttcccgggctgccatgttgcggttgagcagcgcatgccgctgggcacgatg
gacccgctgttcaatccggtgatccaccgggatgacgcggcattccgtgcacgtgcggtg
tcggcgatgcagcaggcgctggccgccaccgatctggctccggcgctgtccgtcgtggag
gcgatcacccgctatccgcagtcggcggcatgcagtgcgcacagcgactgccgtctggcg
ctgaccgacaccagcttcagtgcagccccgggcaacgagccacgcgtctccggatcactg
gccctggccagcggactggtcgatgccttgttgatggagcactaccagggaagtggcatt
ccccgcgaaggctggggccgattgaacacggaggtccaatggcaggcgctggcgcagatc
cgcaaccgctaccaggacatcctgttcggaacacccgaggtggcgcgggatgtggccggg
ccgttgctggcacgcgtggatgcgttgttggaagatcccgcatcgccgaaagtgagcctg
ctggtcggtcacgattccaatatcggttccgtactggcggcgctcggaatcacggactac
acgttgccgggccagtacgagaagacgccgatcggcggcctgctgcagttcgaacgctgg
cgtgatcatggggccggcgaagtgcgttatcgcttggtgtatgtctatcccacgcgcgag
cagttgcgtggttcgatcccgttgaccgacgcgcagccgccggggcgggtggagctggtg
ctgccgggctgtgggcagtcgggctgcagtgaagcgcagttcgagaacctgctgcattca
ccttga

DBGET integrated database retrieval system