KEGG   Stenotrophomonas sp. WZN-1: CCR98_14815Help
Entry
CCR98_14815       CDS       T04963                                 

Definition
(GenBank) tRNA pseudouridine(38-40) synthase TruA
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
sten  Stenotrophomonas sp. WZN-1
Brite
KEGG Orthology (KO) [BR:sten00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sten03016]
    CCR98_14815
Enzymes [BR:sten01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     CCR98_14815
Transfer RNA biogenesis [BR:sten03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CCR98_14815
 Prokaryotic type
    CCR98_14815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: ARZ75385
UniProt: A0A1Z2LMC4
Position
complement(3122005..3122775)
Genome map
AA seq 256 aa AA seqDB search
MRYALGVEYDGSDFRGWQNLGEGGPSVQASLEQALSSVADAPLQVVCAGRTDAGVHGQCQ
VVHFDTDVVRDPRAWMLGTTTRLPRSIAVRWCVPVADDFHARFSARARRYRYRLLNREVR
PALQRQTLSWERRALDAGLMHAAGQALLGENDFSAFRSVQCQALHARRELQSLQVSRQGE
VIEVAVQGNAFLHHMVRNIVGSLILVGSGEKPVEWIAELLAGRDRTVAGPTAPPQGLVFL
GPLYPDNWHLPAEVTL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgcgcttggcgtcgaatacgacggcagcgatttcaggggctggcagaacctg
ggcgagggcggccccagcgtgcaggccagccttgagcaggccctgtcatcggtggccgat
gcgccgctgcaggtggtctgtgccggccgcaccgatgccggcgtgcacggccaatgccag
gtcgtccatttcgataccgacgtggtgcgcgatccgcgcgcctggatgctgggcaccacc
acccgcctgccgcgctcgatcgcggtgcgctggtgcgtgccggtggccgatgatttccat
gcccgtttctcggcgcgtgcgcgccgctaccgctaccgcctgctcaaccgcgaagtgcgg
ccggcgctgcagcggcagaccctcagctgggagcgccgtgcgctggacgcgggcctgatg
catgctgctggccaggccctgcttggcgagaacgacttcagcgcgttccgctcggtgcaa
tgccaggcgctgcatgcacggcgtgaactgcagtcactgcaggtcagccgccagggcgag
gtgatcgaggtcgccgtgcagggcaatgcattccttcatcacatggtccgcaatatcgtc
ggatcgctgatcctggtgggcagtggcgagaagccggtggaatggatcgccgaactgctg
gccgggcgcgatcgcaccgtagccggtcccaccgcaccgccgcagggcctggtgttcctt
gggcccctgtaccccgacaactggcatctgcccgccgaggtcacgctatga

DBGET integrated database retrieval system