KEGG   Stenotrophomonas sp. WZN-1: CCR98_15240Help
Entry
CCR98_15240       CDS       T04963                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00450  Selenocompound metabolism
sten00970  Aminoacyl-tRNA biosynthesis
sten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CCR98_15240
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCR98_15240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sten01007]
    CCR98_15240
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sten03016]
    CCR98_15240
Enzymes [BR:sten01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CCR98_15240
Amino acid related enzymes [BR:sten01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CCR98_15240
Transfer RNA biogenesis [BR:sten03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CCR98_15240
 Prokaryotic type
   Other AARSs
    CCR98_15240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f DUF1610 Ribosomal_60s DUF4573
Motif
Other DBs
NCBI-ProteinID: ARZ75463
UniProt: A0A1Z2LME7
Position
3227820..3229907
Genome map
AA seq 695 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRMSGGKAWFVCADDTHGTPIMLAA
EKAGVTPETFIANIQASHERDFAAFGVAFDHYDSTNSAANQALTEQFYLKLEAAGHISRR
SVAQFYDPAKGMFLPDRYVKGICPNCGSPDQYGDNCEVCGATYAPTDLKEPRSVISGATP
EMRDSEHFFFEVGHFDAFLRDWLAGDVALPGVKAKLGEWLNAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLSSFQTLCGKLGEDFEAHLRAGTSTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDAGLEPEALRYYYAA
KSGGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFISKRFDGQLAAQLPDAAQYQRF
VDGLAPIREAYERNDPAAAIRLTMTLADEANRYIDDVKPWVIAKQEGADAQLQAVCSQGL
NLFRVLVTALKPVLPATATQAEAFLAAPVNDWTELAQPLLGHRITDYTPLFTRIDPKKID
AMIDASKDTLQPAAAAAPAARTEAVKPAAPAPALAKDEAKSTDAPAYIGIDDFAKLDLRI
GKVLVCEFVEGSDKLLRFELDAGDLGKRQIFSGIRGSYGEPEALVGRSVVFIANLAPRKM
RFGLSEGMILSAGFDGGALALLDADSGAQPGMPVR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtaccgcgctcgtcaccaccgccctgccctacgccaacggcccgctgcatctg
ggccacctggtcggctacatccaggccgacatctgggtgcgtgcgcggcgaatgagcggc
ggcaaggcctggttcgtctgcgccgacgacacccacggcacgccgatcatgctggccgcg
gaaaaggccggggtcaccccggaaaccttcatcgccaacatccaggccagccacgaacgt
gacttcgccgccttcggcgtggccttcgatcactacgactcgaccaattcggcggccaac
caggcgctgaccgagcagttctacctgaagctggaagcggccggtcacatcagccgccgt
tcggtcgcgcagttctacgacccggccaagggcatgttcctgcccgaccgctacgtcaag
ggcatctgtccgaactgcggcagccccgaccagtacggcgacaactgcgaagtctgcggc
gcgacctatgcgccgaccgacctgaaggagccgcgctcggtcatctccggtgccacgccg
gaaatgcgcgattcggagcacttcttcttcgaggtgggccacttcgatgcgttcctgcgc
gactggctggccggcgatgtcgccctgccgggcgtgaaggccaagctgggcgaatggctc
aatgccgaaggtggcctgcgcgcgtgggacatctcgcgcgatgcgccgtacttcggcttc
cagattcccggccagccgggcaagtacttctacgtctggctggacgcaccgatcggctac
ctgtccagcttccagaccctgtgcggcaagctcggcgaagacttcgaagcacacctgcgt
gccggcaccagcaccgagctgcaccacttcatcggcaaggacatcgtcaacttccacggc
ctgttctggccggcggtgctgcatggtaccggccaccgcgcgccgacccgcctgcacgtc
aacggctacctgaccgtggacggcgccaagatgagcaagtcgcgtggcaccttcgtgatg
gcgcgtaccttcctcgatgccggcctggagccggaagcgctgcgctactactacgccgcc
aagtccggcggcggcgtcgacgatctcgacctgaacctgggtgacttcatcgcccgcgtc
aacgccgacctggtcggcaagttcgtcaacctggccagccgctgcgccggcttcatcagc
aagcgcttcgacggccagctggccgcgcagctgcccgatgcggcgcagtaccagcgcttc
gtcgatggcctggcgccgatccgtgaagcctacgagcgcaacgacccggccgcggcgatc
cgcctgaccatgaccctggccgacgaagccaaccgctacatcgacgacgtcaagccgtgg
gtcatcgccaagcaggaaggcgccgatgcgcagctgcaggccgtatgcagccagggcctg
aacctgttccgcgtactggtcaccgccctgaagccggtgctgccggccaccgccacgcag
gccgaggccttcctggccgccccggtgaacgactggaccgagctggcgcagccgctgctg
ggccaccgcatcaccgactacaccccactgttcacccgtatcgacccgaagaagattgac
gccatgatcgacgcctccaaggacaccctgcagccggccgccgctgccgcccccgccgcc
aggaccgaagcggtcaagccggccgcaccggcaccggcactggccaaggacgaagccaag
agcaccgacgccccggcctacatcggcatcgacgatttcgccaagctcgacctgcgcatc
ggcaaggtgctggtgtgcgagttcgtggaaggttcggacaagctgctccgcttcgaactg
gacgccggcgacctgggcaagcgccagatcttctccggcatccgtggcagctacggcgaa
ccggaagcacttgttggccgcagcgtggtgttcatcgccaacctggccccgcgcaagatg
cgcttcggcctgagcgaaggcatgatcctgtcggccggtttcgacggcggcgcactggcg
ctgctggacgccgacagcggcgcacagccgggcatgccggtccgctga

DBGET integrated database retrieval system