KEGG   Stenotrophomonas sp. WZN-1: CCR98_15750Help
Entry
CCR98_15750       CDS       T04963                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00640  Propanoate metabolism
sten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCR98_15750 (acnD)
Enzymes [BR:sten01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CCR98_15750 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ARZ75560
UniProt: A0A1Z2LML0
Position
complement(3340068..3342686)
Genome map
AA seq 872 aa AA seqDB search
MNTDYRKNLPGSALDYFDARAAVDAIQPGAYATLPYTSRVLAENLVRRCDPATLGDSLKQ
LIERRRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIADKGGDPAKVNPVVPVQLIVDH
SLAVECGGFDPQAFEKNRAIEDRRNEDRFHFIDWTKLAFENVDVIPPGNGIMHQINLEKM
SPVVYVQDGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIIGV
ELTGRPQPGITATDVVLALTEFLRKERVVGAYLEFFGEGAAALTIGDRATISNMCPEYGA
TAAMFYIDGQTIDYLRLTGREESQVALVENYARTTGLWADDLATAQYERVLRFDLSSVVR
NMAGPSNPHKRVATAELAERGIADEAKLEAGKAEQAQGLMPDGAVIIAAITSCTNTSNPR
NVIAAALLARKANERGLLRKPWVKSSLAPGSKAVQLYLEEAGLLPDLEKLGFGIVAFACT
TCNGMSGALDPAIQQEIIDRDLYSTAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAG
TVRFDIEKDVLGVDADGNEVRLKDIWPSDAEIDAVVKASVKPEQFRKVYNPMFNVRVEHG
AAVSPLYDWRPQSTYIRRPPYWEGALAGERTLSGMRALAVLPDNITTDHLSPSNAILASS
AAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRNDDGSVKQGSLARVE
PEGKVMRMWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIH
RTNLIGMGVLPLEFKPGTTRLTLGIDGTETFDVIGERTPRADLTLVIHRRDGQDVIVPVT
CRLDSDEEVAIYEAGGVLQRFAQDFLEGAKVA
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgattaccgcaagaacctccccggcagcgcgctggattatttcgacgcgcgc
gccgctgtcgatgcgatccagcccggcgcctatgccaccctgccgtacacctcgcgcgtg
ctggccgagaacctggtgcgccgctgcgatccggccacgctcggggattcgctgaagcag
ctgatcgagcgccgccgggacctcgatttcccgtggtttccggcgcgcgttgtgtgccac
gacatcctcggccagaccgcactggtcgacctggccggcctgcgtgatgcgatcgccgac
aagggcggtgacccggccaaggtgaatccggtggtgccggtgcagctgatcgtcgatcac
tcgctggcggtggagtgcggaggtttcgatccgcaggcgttcgagaagaaccgcgccatc
gaagatcgccgcaatgaagaccgtttccacttcatcgactggaccaagctggcgttcgag
aacgtggacgtgattccgccgggcaacggcatcatgcaccagatcaacctggagaaaatg
tcgccggtggtctacgtgcaggacggcgtggccttcccggatacctgcgtgggtaccgac
agccataccccgcacgtggatgcgctgggcgtgatcgcgattggtgttggcggcctggaa
gccgagaacgtgatgctggggcgcgcgtcatggatgcgcctgccggacatcatcggtgtc
gagctgaccggcaggccgcagccgggcatcactgccaccgacgtggtactggcactgacc
gagttcctgcgcaaggaacgcgtggtgggtgcgtatcttgaattcttcggcgagggtgcc
gcggcgctgaccatcggtgaccgcgccaccatctccaacatgtgcccggagtacggcgcg
accgccgcgatgttctacatcgacgggcagaccatcgattacctgcgcctgaccggccgc
gaggaatcgcaggtggcgctggtggagaactacgcgcgtaccaccggcctgtgggctgat
gatctggccaccgcgcagtacgagcgcgtgctgcgcttcgacctgtccagcgtggtgcgc
aacatggccggcccgtccaacccgcacaagcgcgtggccaccgccgagctggccgagcgc
ggcattgccgacgaagccaagctggaagcgggcaaggccgagcaggcgcaggggctgatg
cccgatggcgcggtgatcatcgccgccatcaccagctgcaccaatacgtccaatccgcgc
aacgtgatcgccgccgcactgctggcgcgcaaggccaacgagcgtggcctgctgcgcaag
ccgtgggtgaagtcgtcgctggcgccgggctcgaaggcggtgcagctgtacctggaagag
gcgggcctgctgccggacctggaaaagctcggcttcggcatcgtcgccttcgcctgcacc
acctgcaacggcatgagtggcgcgctggatccggcgatccagcaggagatcatcgatcgc
gacctgtattccaccgccgtgctgtcgggcaaccgcaacttcgatggccgcatccacccg
tacgcgaagcaggccttcctggcctcgccgccgctggtgatcgcctatgccatcgccggc
accgtgcgcttcgatatcgagaaggacgtgctgggcgtggatgccgatggcaacgaagtg
cgcctgaaggacatctggccgagtgacgccgagatcgatgcggtggtgaaggcttcggtg
aagccggagcagttccgcaaggtctacaacccgatgttcaacgtgcgcgtggagcatggc
gcagcggtcagcccgctgtatgactggcgcccgcagagcacctacatccgccgtccgccg
tactgggagggcgcactggccggtgagcgcacgctgtctggcatgcgcgcgctggcggtg
ctgccggacaacatcaccaccgaccacctgtcgccgtccaacgcgatcctggcgtccagt
gccgccggtgagtacctggcgaagatgggcctgccggaagaggacttcaattcctacgcc
acccaccgcggtgaccacctgaccgcgcagcgcgccaccttcgccaacccgaagctgttc
aacgagatggtgcgcaacgacgacggcagcgtgaagcagggttcgctggcgcgcgtggag
ccggaaggcaaggtgatgcgcatgtgggaggcgatcgagacctacatggaccgcaagcag
ccgctcatcatcattgccggtgccgactatggccagggcagctcgcgtgactgggccgcc
aagggcgtgcgcctggctggcgtggaggcgatcgtggccgaaggcttcgagcggattcac
cgtaccaacctgatcggcatgggcgtgctgccgctggagttcaagccgggcaccacccgc
ctgaccctgggcatcgacggcaccgagaccttcgatgtgatcggcgagcgcaccccgcgt
gccgacctgaccctggtcatccaccgccgcgacggccaggacgtgatcgtgccggtcacc
tgccgcctggacagcgacgaggaagtggcgatctacgaagccggcggcgtgctgcagcgc
ttcgcccaggacttcctggaaggggccaaggtggcgtga

DBGET integrated database retrieval system