KEGG   Stenotrophomonas sp. WZN-1: CCR98_17770Help
Entry
CCR98_17770       CDS       T04963                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00520  Amino sugar and nucleotide sugar metabolism
sten01100  Metabolic pathways
sten01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CCR98_17770 (nagA)
Enzymes [BR:sten01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CCR98_17770 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ARZ75939
UniProt: A0A1Z2LNK0
Position
complement(3807003..3808151)
Genome map
AA seq 382 aa AA seqDB search
MATVLRNARILAGDEFRDDLAVVIEDGRISALLPDAAPQLGQAAEQVDLGGGWLLPGFID
VQVNGGGGALFNNTPDVAALRTMAQAHRRFGTTAMLPTLISDDVGVMREAIGAMRAAIAQ
GVPGVIGIHLEGPYIAPARKGTHDASKFRVPDEAEIALAASLDNGVTLLTLAPERVPLET
IRALVERGVIVAAGHTAGTYEEIRDGLDAGVRGFTHLYNAMSPLQGREPGAVGAALEDRD
SWIGIIVDGVHVHPASLRVALAAKPRGRLLLVTDAMPPVGADDPSYVLYGETITAIDGVV
RNAAGSLAGSALDMATAVRNTVQLLGQPLAEAARMASTYPAQFLNVDDRLGHIAEGYQAD
LVLLDDALQVRGTWIAGQYEAA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtgctgcgcaacgcccgcatcctcgccggcgatgaattccgcgacgacctg
gcggtggtgatcgaggacggtcgcatcagcgcgctgctacctgatgccgcaccgcagctg
ggccaggccgccgagcaggtggacctgggcggtggctggctgctgcccggcttcatcgat
gtgcaggtcaatggcggcggcggtgcgctgttcaacaacacgccggacgtagcggcactg
cgcaccatggcgcaggcgcaccgccgctttggcaccaccgcgatgctgcccacgctgatc
agcgatgacgtgggcgtgatgcgcgaggcgatcggtgcgatgcgagcagcgatcgcgcag
ggcgtgccgggcgtgatcggcatccatctggagggcccgtacatcgcgccggcccgcaag
ggcacgcacgatgccagcaagttccgcgtgccggacgaagcggagattgcgctggccgca
tcgctcgacaacggcgtgaccctgctgacgctggcgcccgagcgcgtgccgctggagacc
atccgcgcgctggtcgagcgtggcgtgatcgttgctgctgggcacaccgcaggcacctac
gaagagatccgcgacggcctggatgccggcgtgcgtggcttcacccatctgtacaacgcg
atgtcgccgctgcaggggcgtgagcccggcgcggtgggcgctgcgctggaagaccgcgac
agctggatcggcatcatcgtcgatggcgtgcatgtgcatccggccagcctgcgcgtggcg
ctggcggccaagccgcgcggccgcctgctgctggtgaccgacgcgatgccgccggtcggt
gccgatgatcccagctacgtgctgtatggcgaaaccatcaccgccatcgacggcgtggtg
cgcaatgccgccggttcgctggcgggttcggcgctggacatggccaccgccgtgcgcaat
accgtgcagctgctcggccaaccgctggccgaagcggcgcgcatggcctcgacctatccg
gcgcagttcctcaacgtcgacgaccgcctgggccatattgccgagggctaccaggccgac
ctggtcctgctggatgatgccctgcaggtgcgtggcacctggattgccggacagtacgag
gccgcctga

DBGET integrated database retrieval system