KEGG   Stenotrophomonas sp. WZN-1: CCR98_20630Help
Entry
CCR98_20630       CDS       T04963                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sten00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCR98_20630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sten01007]
    CCR98_20630
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sten03016]
    CCR98_20630
Enzymes [BR:sten01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     CCR98_20630
Amino acid related enzymes [BR:sten01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CCR98_20630
Transfer RNA biogenesis [BR:sten03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CCR98_20630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ARZ76468
UniProt: A0A1Z2LQB2
Position
complement(4430534..4432609)
Genome map
AA seq 691 aa AA seqDB search
MSQLSPLLIELGTEELPVKALPGLAQAFFDGVVEGLRKRGVALELGDARPLSTPRRLAVL
LPGVGLEQPEQHSEVLGPYLNIALDAEGQPTKALQGFAAKAGIDWTALEKTTDNKGERFV
HRAVTPGASTASLLPEILREAIAAMPIPKPMRWGDHAWGFARPAHWLVLLHGANVVEAEL
FGLQAGRVSRGHRFHHDQAVSLAQPQDYVEALRAAFVLVDPRERRARIVAEVEAAAAKAG
GSARITEDNLEQVVNLVEWPSAVLCSFERAFLAVPQEALIETMEINQKFFPVLDAAGTLT
EKFIGIANIESKDVAEVAKGYERVIRPRFADAKFFFDEDLKQGLVSMGEGLKTVTYQAKL
GSVADKVARVAALAEVIAPQVGADPAQAKRAAELAKNDLQSRMVNEFPELQGIAGRHYAV
AGGESAEVALAIDEAYQPRFGGDDIALSPLGKVLAIAERVDTLAGGFAAGLKPTGNKDPF
ALRRNALGLARTIIESGFELDLRALLASANAGLAARNVQADVGELYDFILDRLKGYYADK
GVPATHFNAVAELKPASLYDFDRRLDAIGTFAALPEAEALAAANKRIRNILRKAEGDIPA
QIDPALLQEDAERALAEAVTAAIDDTGASLQHKDYVAVLARLARLRPQVDAFFDGVMVNA
EDPALRGNRLALLTMLGERLGKVAAIEHLSS
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactgtcccccctgctgatcgaactgggcaccgaggagctgccggtcaaggcg
ctgccgggcttggcccaggcgttcttcgacggtgttgtcgaaggcctgcgcaagcgcggc
gtcgcgctggaattgggcgatgcgcgcccgctgtcgaccccgcgccgcctggccgtgctg
ctgccgggcgtcggcctggagcagccggaacagcacagcgaagtgctgggcccgtacctg
aacatcgcgctggacgccgaaggccagccgaccaaggccctgcagggcttcgccgccaag
gccgggatcgactggaccgcgctggagaagaccaccgacaacaagggtgagcgcttcgtg
caccgcgcggtgaccccgggcgcgagcaccgccagcctgctgcccgagatcctgcgcgag
gcgatcgcggcgatgccgattcccaagccgatgcgctggggcgaccacgcctggggcttt
gcgcgtccggcgcactggctggtgctgctgcacggtgccaacgtggtcgaggccgagctg
ttcggcctgcaggccggccgtgtcagccgcggccatcgtttccaccacgaccaggccgtg
tcgctggcgcagccgcaggactacgttgaagccctgcgcgccgcgttcgtgctggtcgac
ccgcgcgagcgccgtgcgcggatcgtcgccgaggtcgaggccgctgcggccaaggccggt
ggcagcgcccgcatcaccgaagacaacctggagcaggtggtgaacctggtcgagtggccg
tcggcagtgctgtgcagcttcgagcgcgcgttcctggcggtgccgcaggaagcgctgatc
gagacgatggagatcaaccagaagttcttcccggtgctggatgccgccggcaccctgacc
gagaagttcatcggcatcgccaacatcgaatcgaaggacgtggccgaagtggccaagggc
tacgagcgcgtgatccgcccgcgcttcgccgatgccaagttcttcttcgacgaggacctg
aagcagggcctggtgtcgatgggcgagggcctgaagacggtgacctaccaggccaagctg
ggcagcgtggccgacaaggtagcgcgggtggccgccctggctgaagtgatcgccccccag
gtcggcgccgatccggcgcaggccaagcgggctgccgagctggccaagaacgacctgcag
tcgcgcatggtcaatgagttcccggagctgcagggcatcgccggtcgccactacgccgtg
gctggtggcgaatcggccgaggtcgcgctggccatcgacgaggcctaccagccgcgcttc
ggcggtgatgacatcgcgctgtcgccgctgggcaaggtgctggcgattgccgagcgcgtc
gacacgctggccggtggcttcgccgcaggcctgaagccgaccggcaacaaggacccgttc
gccctgcgccgcaacgcgctgggcctggcccgcacgatcatcgaaagcggcttcgagctg
gacctgcgcgcgctgctggccagcgccaacgccggcctggccgcgcgcaacgtgcaggcc
gacgtaggcgagctgtacgacttcatcctcgaccgcctgaagggctactacgccgacaag
ggcgtgccggccacgcacttcaatgcggtggccgagctgaagccggcctcgctgtacgac
ttcgaccgccgcttggatgcgatcggcactttcgccgcgctgccggaagccgaggcgctg
gccgcagccaacaagcgcatccgcaacatcctgcgcaaggcggagggcgacattccggcc
cagatcgacccggcgctgctgcaggaagatgccgaacgcgcgctggccgaagcggtcacc
gcagccatcgacgacaccggcgccagcctgcagcacaaggactatgtggcggtgctggca
cgcctggcgcgcctgcgcccgcaggtcgacgcgttcttcgatggcgtgatggtcaatgcg
gaagatccggcgctgcgtggcaaccgcctggcgctgctgacgatgctgggcgagcgcttg
ggcaaggtcgcggcgatcgagcatctgtcgagctga

DBGET integrated database retrieval system