KEGG   Sphingopyxis terrae: AOA14_02595Help
Entry
AOA14_02595       CDS       T04307                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
ster  Sphingopyxis terrae
Brite
KEGG Orthology (KO) [BR:ster00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOA14_02595
Enzymes [BR:ster01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     AOA14_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AMU93492
UniProt: A0A142VUU9
Position
540330..542510
Genome map
AA seq 726 aa AA seqDB search
MAKRVMATALLCGAALVLAGCNASKSGGTGRSLDDAERASEALLKTGGNGDNWAGIGYGY
DEQRFSPLTDINDKNVGELGIAWFADLEDARGQEATPVVVDGTLYVSHAWSKVDAWDAGT
GKKLWSFDPKVSGDRAVNACCDVVNRGVAVWGDKLFVGALDGRLIALDRKTGKELWSTQT
FDPQKPYTITGAPRVVKDMVLIGSGGAEFGVRGYVTAYDADTGKERWRFYTAPNPEKKKD
GAASDDIFASKGNATWSDQGEWKTSGGGGTVWDAIVYDKDLDQIYLGVGNGNPWNHGTRS
NGEGDNWFLSSVVALDASTGKYKWHYQETPGESWDYTATQPIILAEQAVNGTPTKVLYHA
PKNGFFFTIDRTTGKLIDAKPFVDGINWATGYDMATGRPIENPDARFYKTGKPFIAIPGA
LGAHNWHPMSYNPATGLVYIPAQQIPQGYIQDMDELDRRKVLGFNIGASLTAAMLPDDKA
AFRAAVAATTGRLVAFDPRTGKVAWGVDYPAAWNGGTMTTAGNLVFQGTSTGRFRAYAAD
TGKQLLDLDMQSGIVSAPSTFRVGGVQYVAFQTSKGGAFPLVAGVAGGVTRKVPNIPRLV
VLKLGGTVQLPAPPATTTLAWNPPAQFGTPQQIASGKAHFGRYCQVCHGDSAIGNGFTPD
LRVSGALTSADAWKGVILDGALKDRGMVSFAKVLSPADVEAIRAYVIDRSNWTKANLPDA
SAPVGR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgggtcatggcgaccgcgctgctttgtggtgcggccttggttctggcgggt
tgcaacgcgtcgaagtcgggcggcacgggcaggtcgctcgacgatgccgagagggcgagc
gaagcactgctcaagaccggcggcaacggcgacaactgggccggcatcggctatggctat
gacgagcagcgcttcagcccgctcaccgacataaacgacaagaatgtgggcgagcttggc
attgcctggttcgccgatcttgaggacgcgcgcggacaggaagccaccccggtcgtcgtc
gatggcaccctttatgtcagccacgcctggtcgaaggtcgacgcgtgggacgccgggacc
ggcaagaagctctggtccttcgatcccaaggtgtcgggcgaccgcgcggtcaacgcctgc
tgcgacgtcgtcaaccgcggcgtcgcggtatggggcgacaagctcttcgtcggcgcactc
gacgggcggctgatcgcgctcgatcgcaagaccggcaaggaattgtggtcgacgcagacc
ttcgatccccaaaagccctacacgatcaccggcgcgccgcgcgtcgtgaaggacatggtg
ctcatcggcagcggcggcgccgaattcggggtgcgcggctatgtcaccgcctatgatgcc
gataccggcaaggaacgctggcgcttctacaccgcgccgaaccccgaaaagaagaaggac
ggcgccgcaagcgacgacatcttcgcgtcgaaaggcaatgcaacctggtcagaccaaggg
gaatggaagacgtcgggcggcggcggcacggtgtgggacgcgatcgtctatgacaaggat
ctcgaccagatctatctcggcgtcggcaacggcaatccgtggaaccatggcacgcgttcg
aacggcgaaggcgacaactggttcctctcgtccgtggtggcgctcgatgcgtcgaccggc
aaatataaatggcattatcaggaaacgcccggcgagagctgggactataccgcgacgcag
ccgatcatccttgccgagcaggcggtgaacggcacgccgaccaaagtgctgtatcatgca
ccgaagaacggctttttcttcacgatcgaccggaccaccggcaagctgatcgacgccaag
cctttcgtcgacgggatcaactgggcgaccggctatgacatggccactggccggccgatc
gaaaatcccgacgcgcgcttctacaagaccggcaagcccttcatcgcgatcccgggcgcg
cttggcgcgcacaactggcatccgatgagctacaaccctgctaccggcctcgtctatatt
ccggcgcagcagattccgcagggctatatccaggatatggatgagctggaccggcgcaag
gtactcggcttcaacatcggcgcctcgctgaccgcagcgatgctccccgacgacaaggct
gccttccgcgcggccgtcgccgcgaccaccggccgtctcgttgccttcgacccgcgcacc
ggcaaggtcgcttggggcgtcgactatcccgccgcatggaacggcggcacgatgacgacc
gccggcaatctggttttccagggaacgagcaccgggcgcttccgcgcctatgccgccgac
accggcaagcagctgctcgacctcgacatgcagtcggggatcgtcagcgcgccatcgacc
ttccgcgtgggcggagtgcaatatgtcgctttccagaccagcaagggcggcgcctttcca
cttgtcgccggggtcgcgggcggagtgacgcgcaaggtgcccaatattccgcgcctcgtg
gtgctcaagctcggcggtacggtgcagctccccgccccgcccgcgaccacgacgctggcg
tggaatccgcccgcgcagttcggcacgccgcagcagatcgcatcgggcaaggcgcatttc
gggcgctattgccaagtctgtcacggcgacagcgcgatcggcaacggcttcacccccgac
ctgcgcgtttcgggtgcgctgaccagtgccgatgcatggaagggcgtgatcctcgacggc
gcgctgaaggaccgcggcatggtgagctttgccaaggtgctctcccccgccgatgtcgag
gcgattcgcgcctatgtcatcgaccggtcgaactggaccaaggctaacctgcccgacgcg
tcggcgcccgtcgggcgctga

DBGET integrated database retrieval system