KEGG   Sphingopyxis terrae: AOA14_03870Help
Entry
AOA14_03870       CDS       T04307                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ster  Sphingopyxis terrae
Pathway
ster00360  Phenylalanine metabolism
ster00362  Benzoate degradation
ster00621  Dioxin degradation
ster00622  Xylene degradation
ster01100  Metabolic pathways
ster01120  Microbial metabolism in diverse environments
ster01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AOA14_03870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOA14_03870
   00622 Xylene degradation
    AOA14_03870
   00621 Dioxin degradation
    AOA14_03870
Enzymes [BR:ster01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AOA14_03870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AMU93739
UniProt: A0A142VVI3
Position
complement(786245..787267)
Genome map
AA seq 340 aa AA seqDB search
MSFDPTTTKLYIQDVTLRDGMHAIRHQYGLDHVGAIAKALDAAKVDAIEVSHGDGLQGSS
FNYGFGAHTDWDWIGAVAEVLEHSVLTTLLLPGIGTVHDLKRAYDLGVRSVRIATHCTEA
DVAKQHIEAARGLGMDVSGFLMMSHMSEPDALANQAKLMEDYGAHCVYVTDSGGALTMDG
YAARLAAYDRVLKPETQRGVHAHHNLSLGVANSIVAVQNGAIRVDASLAGMGAGAGNAPL
EVFIAAADVYGWNHGCDLFALMDAAEELVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAE
KAAAEHGLDTRAILVELGRRKMVGGQEDMIVDVALDMAKQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgacccgaccacgaccaaactctatatccaggacgtcacccttcgcgacgga
atgcacgcgatccgccaccaatatgggctcgaccatgtcggcgcgatcgcgaaagcgctc
gacgccgcaaaggtcgatgcgatcgaagtgtcgcacggcgatggtctgcagggatcgagc
ttcaactatggcttcggcgcccacaccgactgggactggatcggcgcagttgccgaggtg
ctcgagcatagtgtgctgacgacgctgctgctgccgggcatcggcacggttcacgacctc
aagcgtgcatacgaccttggcgttcgctcggtgcggatcgcgacccactgcaccgaggcc
gacgtcgcgaaacagcatatcgaggcggcgcgggggctgggtatggacgtatccggcttc
ctgatgatgagccacatgtcggagcccgacgcgctcgcgaaccaggcgaagctgatggag
gattatggcgcacattgcgtctatgtcaccgacagcggcggcgcgctgacgatggacggt
tatgcagcgcgcctcgccgcctacgaccgcgtcctcaagcccgagacgcagcgcggggtc
cacgcgcaccacaatctcagcctcggcgtcgcgaacagcatcgtcgcggtgcagaatggt
gcgatccgcgtcgacgccagcctcgccggcatgggggcaggggcgggcaatgcgccgctc
gaagtcttcatcgccgccgccgatgtatatggctggaaccatggctgcgacctgttcgca
ctgatggatgcggccgaggaactggtgcgcccgctgcaggaccgcccggtgcgcgtcgat
cgcgagacactgacgctcggctatgcgggggtttactccagcttcctccgacatgccgaa
aaagcggcggccgagcacggcctcgatacgcgcgcgatcctcgtcgaactcggccgccgc
aagatggtcggcggacaggaagacatgatcgtcgatgtcgcgctcgacatggcgaagcaa
tag

DBGET integrated database retrieval system