KEGG   Sphingopyxis terrae: AOA14_12610Help
Entry
AOA14_12610       CDS       T04307                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ster  Sphingopyxis terrae
Brite
KEGG Orthology (KO) [BR:ster00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AOA14_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AMU95450
UniProt: A0A142W059
Position
2622316..2623329
Genome map
AA seq 337 aa AA seqDB search
MHELAFPLLVGLVLLALAFDFLNGLHDAANSIATVVATRLLKPVQAVMFAAFFNFAAYFL
SLAFPQLHKVAETIGAGLIDKDLVTPAVVFGALVGAMFWNVVTWLKGIPSSSSHALVGGI
VGAGIAHSGFEGIQWSGLNKTVIAIFLSPLLGMLLSMLVMLLSSWAFRRSTAKFAEVTFR
RLHLVSSAAYSLSHGLNDAQKTMGVITVLLYSTGYLTGDFHVPHWVAISCYIAIGLGTLS
GGWKIIETMGGRITKLSQHQGFAASTGGSIMVFTASLLGIPVSTTHTITGSIIGAGVARR
ASAVRWGVASNVVVAWFITIPASAIVAALFYSLTRLF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaactggcatttcctcttctcgtcgggctggtcctcctcgcgctggcgttcgac
tttctgaacggcctgcacgacgccgcaaacagcattgcgaccgttgtcgcgacgcggctg
ctgaagcccgtgcaggcggtgatgttcgccgccttcttcaacttcgcggcctatttcctg
agcctcgcttttccgcaattgcacaaggtggcagaaacgatcggcgcggggctgatcgac
aaggatctggtcacgcccgcggtggtgttcggcgccttggtcggcgcgatgttctggaat
gtcgtcacttggctgaagggcatcccgtcctcgtcgagccatgcgctcgtcggcggcatc
gtcggcgcgggcatcgctcattcgggattcgagggcatccagtggtcggggctcaacaag
acggtcatcgcgatcttcttgtcgccgctcctcggcatgctgctctcgatgctcgtgatg
ctgctcagcagctgggcgttccggcgttcgaccgcgaaattcgccgaggtcacgttccgc
cgcctgcatctcgtttcgtcggccgcctattcgctcagccacgggctcaacgatgcgcag
aagacgatgggcgtcatcacagtgctgctttattcgaccggctatctgaccggcgatttc
catgtgccgcactgggtggcaatcagctgctatatcgcgatcggtctcggtaccttgtcg
ggcgggtggaagattatcgagacgatgggcggccgcatcaccaaattgtcgcagcatcag
ggctttgccgcctcgaccggcgggtcgatcatggtgttcaccgccagcctgctcggcatc
ccggtgtcgacgacccatacgatcaccggcagcatcatcggcgccggtgtcgcgcgccgc
gccagtgcagtgcgctggggcgtggcgagcaacgtcgtcgtcgcctggttcatcaccatc
ccggcgagtgcgatcgttgcagcactcttctattcgcttacgcgcctgttctga

DBGET integrated database retrieval system