KEGG   Sphingopyxis terrae: AOA14_13870Help
Entry
AOA14_13870       CDS       T04307                                 

Definition
(GenBank) aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ster  Sphingopyxis terrae
Pathway
ster00860  Porphyrin and chlorophyll metabolism
ster01100  Metabolic pathways
ster01110  Biosynthesis of secondary metabolites
ster01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOA14_13870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ster01007]
    AOA14_13870
Enzymes [BR:ster01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AOA14_13870
Amino acid related enzymes [BR:ster01007]
 Aminotransferase (transaminase)
  Class III
   AOA14_13870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 AIRS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMU95697
UniProt: A0A142W2B5
Position
complement(2913192..2914535)
Genome map
AA seq 447 aa AA seqDB search
MIADAAIARVAAREADRFRADNPHAFAHQAAATGWFQSVPFHWMKDWPSPAPIVAASAKD
ATLTSIDGRTYDDFCLGDTASLFGHSPPALAAALARQAAEGLSYMLPTARGAALAAKLSA
MFGFPQWQVTTTASEANRAVIRWCRGISGRPKILTFNGAYHGAVDDVFVDLKNGAPVMRA
SLIGQVHDLRGTTTVIEFNDAGALAAALRSGDIACVLAEPVMTNVGMVQDAPGFLETLRS
LCDETGTLLVFDETHSISSGYGGHARTHGPMADLMVVGKSIGGGVPCAVYGFSAAVAERM
AALNRRRPPGHSGIGTTLSANALAITAMDVMLGEVITPTAYDAMLRGAARLVTGLEREIA
AASLDWHVTQVGARVEFLTCLVPPRSGGEAKAAMHPALEAAIHIFLANRGILLAPFHNMM
LVSPVTGDDQIDRLVGGFADCIKALKE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgacgccgccatcgcccgcgtcgccgcgcgcgaggccgatcgtttccgcgcc
gacaacccgcatgctttcgcgcatcaggccgcggcgaccggctggttccagtcagtgccc
ttccactggatgaaggattggcccagcccggccccgatcgtcgccgcctcggccaaggac
gcgacgctgaccagcatcgacgggcggacctatgacgatttctgccttggcgacacggcc
agcctgttcggccattcgccgcccgcgctcgcggccgcgctcgcacggcaggcggccgag
gggctgagctatatgctgcccaccgcccgcggtgccgcgctggccgcgaagctttcggcc
atgttcggctttccgcaatggcaggtgacgaccacggcgagcgaagccaatcgcgccgtc
atccgctggtgccgcgggatcagcgggcgcccgaaaatcctcaccttcaacggcgcctat
catggcgccgtcgacgatgtgttcgtcgatctgaaaaacggcgcgccggtgatgcgcgcc
agcctgatcggccaggtccacgatcttcgcggcacgacgacggtgatcgagttcaacgat
gcgggcgcgcttgccgccgcgctgcgcagcggcgatatcgcctgcgtcctcgccgaaccc
gtcatgaccaacgtcggcatggtgcaggacgcgccgggcttcctcgaaacgctgcgcagc
ctgtgcgacgagacgggcacgctgctggttttcgacgaaacgcacagcatctcttcgggc
tatggcggccatgcccgcacccacggccctatggcggatctgatggtcgtcggaaagtcg
atcggcggcggcgtgccgtgcgccgtctatggtttcagcgccgcggtcgcggagcgcatg
gcggcgctcaacaggaggcgcccgccggggcatagcggcatcggcacgacgctctccgcc
aacgcgcttgcgatcactgcgatggacgtcatgctcggcgaggtcatcacccccaccgcc
tatgacgccatgttgcgcggcgccgcgcggctggtcacggggctggagcgcgaaatcgcc
gctgcgtcgctcgactggcacgtcacgcaggtcggcgcgcgcgtcgagtttctgacctgt
ctcgtcccgccccgcagcggcggcgaggcgaaggcggcgatgcaccccgcgctggaggcc
gcgatccacattttcctcgccaatcggggaattttgctggcgccatttcacaatatgatg
ttggtgagcccggtgaccggcgacgaccagatcgaccggctggtcggcggcttcgccgac
tgcatcaaggcgctgaaggagtag

DBGET integrated database retrieval system