KEGG   Sphingopyxis terrae: AOA14_14410Help
Entry
AOA14_14410       CDS       T04307                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ster  Sphingopyxis terrae
Pathway
ster00071  Fatty acid degradation
ster00072  Synthesis and degradation of ketone bodies
ster00280  Valine, leucine and isoleucine degradation
ster00310  Lysine degradation
ster00362  Benzoate degradation
ster00380  Tryptophan metabolism
ster00620  Pyruvate metabolism
ster00630  Glyoxylate and dicarboxylate metabolism
ster00640  Propanoate metabolism
ster00650  Butanoate metabolism
ster00900  Terpenoid backbone biosynthesis
ster01100  Metabolic pathways
ster01110  Biosynthesis of secondary metabolites
ster01120  Microbial metabolism in diverse environments
ster01130  Biosynthesis of antibiotics
ster01200  Carbon metabolism
ster01212  Fatty acid metabolism
ster02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOA14_14410
   00630 Glyoxylate and dicarboxylate metabolism
    AOA14_14410
   00640 Propanoate metabolism
    AOA14_14410
   00650 Butanoate metabolism
    AOA14_14410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOA14_14410
   00072 Synthesis and degradation of ketone bodies
    AOA14_14410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOA14_14410
   00310 Lysine degradation
    AOA14_14410
   00380 Tryptophan metabolism
    AOA14_14410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOA14_14410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOA14_14410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOA14_14410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ster04147]
    AOA14_14410
Enzymes [BR:ster01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOA14_14410
Exosome [BR:ster04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOA14_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMU95803
UniProt: A0A142W194
Position
complement(3027750..3028964)
Genome map
AA seq 404 aa AA seqDB search
MTLRRAAIVAPIRTAVGKFGGSLSSMTAGALGAVILKALMERTKIDPARVDDVVFSQGYG
NGEAPAIGHWSWLAAGLPLDVPGYQLDRRCGSGLQAVVNAAMMVQTGMSDVVVAGGVESM
SNVEHYSTDIRKGVRAGNLTLHDRLTRGRLMSQPVERFGVITGMIETAENLAKDYDISRE
ACDAYAVRSHQRAAAAWANGLFDDELVPVSVPQKKGDPVVFAHDEGYRADATMETLGKLR
ALEGGVVTAGNASQQNDAAAACLVVAEDKLDELGLTPIAWYHSSAAAGCDPSRMGIGPVP
AVERLFARNGLGWGDIDLVELNEAFAPQVLAVLKGWGWSDDDSRNEILNVNGSGISLGHP
IGATGGRILANLTRELVRRNGRYGLETMCIGGGQGIAAIFERAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgccgcgccgccatcgtcgccccgatccgcaccgccgtcggcaagttcggc
ggctcgctgtcctccatgaccgccggcgccctcggcgcggtcattctgaaggcgctcatg
gagcgcacgaagatcgaccccgcgcgcgtcgatgacgtcgtcttttcgcagggctatggc
aatggcgaagcgccggcgatcggccactggtcgtggcttgcagcagggctgccgctcgac
gtgccgggctaccagctcgaccgccgctgcggctcgggactgcaggcggtcgtcaacgcc
gcaatgatggtccagaccggcatgtccgacgtcgtcgtcgcgggcggcgtcgaatcgatg
tcgaacgtcgagcattattcgaccgatatccgcaagggcgtgcgggcggggaacctcacg
ctccacgaccggctgacccgcgggcggctgatgtcgcagcccgtcgaacgcttcggcgtc
atcaccgggatgatcgagaccgcagaaaatctcgccaaggattatgacatcagccgcgag
gcctgcgacgcctatgccgtgcgcagccaccagcgcgccgccgccgcctgggcgaatggc
ctgttcgatgacgaactcgtccccgtctcggtcccgcagaaaaagggcgacccggtcgtc
ttcgcccacgacgaaggctaccgcgccgacgcgacgatggaaacattgggcaaattgcgc
gcactcgaaggcggcgtcgtcaccgcgggcaacgccagccaacagaatgacgccgccgcc
gcgtgcctcgtggtcgccgaagacaagctcgacgaactcgggctgacccccatcgcctgg
tatcacagctcggctgcggcgggctgcgaccccagccgcatgggcatcggccccgtcccg
gccgtcgaacgcctcttcgcgcgcaatggcctcggctggggcgacatcgaccttgtcgaa
ctcaacgaagccttcgcgccgcaggtgctcgcggtgctcaagggctggggctggtccgac
gacgacagccggaacgaaatcctcaacgtcaacggctcgggcatctcgctcggccatccg
atcggcgcgaccggcggccgcatcctcgccaatctgacgcgcgaactcgttcgcaggaat
ggccgctacggccttgaaaccatgtgtatcggcggcggccaaggcatcgccgcgatcttc
gagcgcgcggcttga

DBGET integrated database retrieval system