KEGG   Sphingopyxis terrae: AOA14_15685Help
Entry
AOA14_15685       CDS       T04307                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ster  Sphingopyxis terrae
Brite
KEGG Orthology (KO) [BR:ster00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AOA14_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMU96048
UniProt: A0A142W1W7
Position
complement(3299052..3299453)
Genome map
AA seq 133 aa AA seqDB search
MIDSLFPFAATTGPITVRVSVSYLPEQSHPALGRWFWAYHVRIENHGEAAVQLLTRHWRI
TDGREQVSEVEGEGVVGEQPLIAPGGSFDYVSGCPLPTPEGGMVGTYVMEMTDGSQMLAA
IPAFPLVAPATAS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactccctcttcccctttgccgcgacaaccgggccgatcacggtgcgcgtgtcg
gtcagctacctgcccgaacagtcgcatccggcgctggggcgctggttctgggcctatcat
gtccgcatcgaaaatcacggtgaggccgcggtgcagctgttgacgcggcattggcggatc
accgacggccgcgagcaggtgagcgaggttgagggcgaaggcgttgtcggcgaacagccg
ctcatcgcgcccggcgggtcgttcgactatgtttcgggatgcccgctgccgacgcccgaa
ggcgggatggtcggcacctatgtgatggaaatgaccgacgggtcgcagatgctggcggca
attccggcctttccgctcgtggcccccgcgaccgcgtcatga

DBGET integrated database retrieval system