KEGG   Stenotrophomonas sp. ASS1: MG068_03345Help
Entry
MG068_03345       CDS       T06051                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
stes  Stenotrophomonas sp. ASS1
Brite
KEGG Orthology (KO) [BR:stes00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MG068_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 N_BRCA1_IG
Motif
Other DBs
NCBI-ProteinID: QBL39606
UniProt: A0A4P6VW87
Position
complement(737361..737744)
Genome map
AA seq 127 aa AA seqDB search
MEDADVYAISVEVAPRFLDDQSAPEDGRYAFAYTIRIHNQGRVAARLVARHWRITDANGR
VEHVDGDGVIGEQPRLRPGEDFHYTSGVMLGTDHGTMQGHYDMVADDGTEFAAPVAPFVL
AIPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgctgacgtttatgccatctccgtcgaagtcgcaccgcgcttcctcgacgat
caatccgcgccggaagacgggcgctatgcgttcgcctacacgatccgcatccacaaccag
gggcgtgttgccgcgcgcctggtcgcacgccactggcgcatcaccgatgccaacggccgc
gtcgagcacgtcgatggtgacggggtgatcggcgagcagccgcgcctgcgtcccggtgaa
gacttccattacacgtccggtgtcatgctggggaccgatcacgggaccatgcagggccac
tacgacatggtcgccgacgacggcaccgaatttgccgcgccggtcgcacctttcgtgctg
gccatcccgcgtaccctgcactga

DBGET integrated database retrieval system