KEGG   Streptococcus salivarius 57.I: Ssal_00461Help
Entry
Ssal_00461        CDS       T02088                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01130  Biosynthesis of antibiotics
stf01230  Biosynthesis of amino acids
Module
stf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssal_00461 (trpC)
Enzymes [BR:stf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ssal_00461 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Tox-MPTase4
Motif
Other DBs
NCBI-ProteinID: AEJ52843
UniProt: F8HGA4
Position
414158..414925
Genome map
AA seq 255 aa AA seqDB search
MSKAFLPTILEQKEKEVAQLVMEDLQPLRQTYRLYDFLKSNQNKLQIISEVKKASPSMGD
INLDVDIVAQAKTYEENGAAMISVLTDEVFFKGDISYLKEISSQVAIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVAALPEARLKELYDFATSLGLEVLVETHNLPELEVAHRIGAEIIG
VNNRNLVTFETDINTSLELSTHFKDKPVYISESAIFTGQDAALVAPYFNGILVGTALMTA
ENVAEKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcctttctcccaacaatcttagaacaaaaagaaaaagaggttgcccagctg
gtcatggaagacttgcagcccttacgtcagacctatcgtctttatgattttctcaagtca
aatcaaaacaagctgcaaattatttctgaagtgaaaaaagccagtccaagcatgggtgat
attaacctagatgtggatattgtggctcaggccaagacctatgaagaaaatggggcagcc
atgatttctgttttgacagacgaggtcttcttcaagggtgatatttcctatttgaaagaa
atttcgtcacaggtggctattccaaccttggctaaggacttcattattgatgagaaacag
attgtgcgtagtcgtaatgcgggtgcgacagtcattctcttgattgtagcggccttgcca
gaagctcgtcttaaggagctctacgattttgcgacaagccttggcttggaagtcttggtt
gaaacgcataatctgccagaattggaagtggctcatcgtattggtgctgagattatcggt
gttaacaaccgtaatttggttacttttgagacagatatcaacaccagtctagagttatca
acgcatttcaaggacaagcctgtttatatttctgagtcggctatttttacaggtcaggat
gctgccttagttgccccatattttaatgggattctagtaggaactgcccttatgacagct
gaaaatgtggctgaaaaggtcaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system