KEGG   Streptococcus salivarius 57.I: Ssal_00775Help
Entry
Ssal_00775        CDS       T02088                                 

Gene name
galM
Definition
(GenBank) galactose-mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00052  Galactose metabolism
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
Module
stf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_00775 (galM)
   00052 Galactose metabolism
    Ssal_00775 (galM)
Enzymes [BR:stf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Ssal_00775 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MSP
Motif
Other DBs
NCBI-ProteinID: AEJ53117
UniProt: F8HC61
Position
786369..787415
Genome map
AA seq 348 aa AA seqDB search
MKISCEIIGKVDSGDVSKISMENNNGVVISTLTTGATLQEFLVPTETGALKNIVLGFSDY
EDYYKNNLCACQSIGRVAGRIGKASYTHNMVLYSLPKNEGENCLHGGPKGMQVQNWNYVT
NLNDEYVETKFVRRLYSSVDGFPGDVTVSISYRLNNNNRLTILFEAFDVTESTVFNPTNH
VYFNLSDKQDLSSHELQIYSDYRLELDSELIPTGQKINVDGTNYDFRKTTDLLPQIEANN
GFDDAFVVGGETCDHVKKVAILHDKESGDGIEIFSNRNGLVIYTMDIIEDNIYFARDRGT
IAKGREAIAMEAQTLPDAVNHTDFGDIILEEGHSVSYEIGFQYFNSSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagctgcgaaattattggaaaagttgattcaggcgatgtcagtaaaatttca
atggaaaataataatggtgttgtcatttctacactcacaacaggtgctacacttcaggag
tttttggttccaacggaaaccggtgctcttaaaaatatagtacttggcttcagtgattac
gaggattactataagaataacttatgtgcctgccagtccattggtagggttgctggaaga
attgggaaagcttcgtatactcataatatggttctttatagtcttcctaagaatgaggga
gaaaactgtttacatggtggtccaaaaggaatgcaggttcaaaattggaactatgtcaca
aacctgaatgatgaatatgttgagacaaagtttgttagaagactttattcaagtgtagat
ggctttcctggtgatgttacagtctctattagttatagacttaacaataataaccgctta
acaatactctttgaagccttcgatgttacagagtcaacagtctttaatccgacaaaccat
gtttactttaatcttagtgacaaacaggatttatcaagtcatgagttacaaatctattca
gactatcgtttagagttggattctgagttaattccaacaggacaaaaaattaatgtagat
ggaacaaattatgactttagaaagacaactgacttactacctcaaattgaagcaaataac
ggttttgatgatgcctttgtagttggaggggaaacttgtgatcatgtgaaaaaagtagct
attttgcatgacaaagaaagcggagatggtattgaaatcttctctaacagaaatggttta
gttatttatactatggatattatagaggataatatttactttgcgagagatcgaggaaca
attgcaaaaggacgagaagctatagctatggaagctcaaacactcccagatgccgttaat
catacagattttggagatatcatcttggaggagggtcatagtgtaagctatgaaatcggt
ttccaatattttaattcatcaaaataa

DBGET integrated database retrieval system