KEGG   Streptococcus salivarius 57.I: Ssal_00992Help
Entry
Ssal_00992        CDS       T02088                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00350  Tyrosine metabolism
stf00625  Chloroalkane and chloroalkene degradation
stf00626  Naphthalene degradation
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
stf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_00992 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Ssal_00992 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ssal_00992 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ssal_00992 (adhP)
   00626 Naphthalene degradation
    Ssal_00992 (adhP)
Enzymes [BR:stf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ssal_00992 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N AlaDh_PNT_C Methyltransf_25 TrkA_N 2-Hacid_dh_C Methyltransf_31 MTS Sacchrp_dh_NADP Met_10 Methyltransf_11 CMAS
Motif
Other DBs
NCBI-ProteinID: AEJ53305
UniProt: F8HCV3
Position
985719..985982
Genome map
AA seq 87 aa AA seqDB search
MTTYKTIKKAKVEPGQWVAIYGAGGLGNLAIQYAKKVFNARVVAVDINQDKLALAKESGA
DLVVNGKEVEDVAGYIQEKLVVHTVLL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacatataagactattaaaaaagctaaagttgaaccaggtcaatgggtagctatt
tatggtgctggaggactaggtaacttggctattcaatatgctaagaaagttttcaatgct
cgagtagtggctgttgatatcaaccaagataaacttgctttggctaaggaatctggtgct
gatttagtggtgaacggtaaagaagttgaagatgtagcaggctatatccaagaaaaactg
gtagtacacacagtgctgttgtaa

DBGET integrated database retrieval system