KEGG   Streptococcus salivarius 57.I: Ssal_01160Help
Entry
Ssal_01160        CDS       T02088                                 

Gene name
bglA
Definition
(GenBank) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01160 (bglA)
   00500 Starch and sucrose metabolism
    Ssal_01160 (bglA)
Enzymes [BR:stf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Ssal_01160 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AEJ53458
UniProt: F8HDA6
Position
complement(1154120..1155556)
Genome map
AA seq 478 aa AA seqDB search
MTYTFPKDFLWGGATAANQFEGAYNLDGKGLSVQDVTPKGGVPLEPGALDPLITDQPTPD
NLKLEGIDFYHRYKEDIALFAEMGFKVFRMSIAWSRIFPNGDDAEPNEAGLAFYDKVFDE
LAKYGIEPLVTLSHYETPLNLAREYNGWTNRKLIGFYENYVRTVFTRYKDKVKYWLTFNE
VNSVLHAPFMSGGIATPMEELSKQDLYQAVHHELVASASATKIGHDINPDFKIGCMVLAM
PAYGMTANPLDQLAVHEFENQNYLFSDIHARGKYPNYIKRYFKDNGIEIQFAPGDEEILK
NTVDFISFSYYMSVATAHNPEDYTIGKGNIMGGVENPYLEKSEWGWAIDPIGLRLVLNDF
YDRYQLPLFIVENGLGAKDVLVDGPDGPIVEDDYRIDYLQKHLIQVGEALQDGVELWGYT
TWGPIDLVSASTAELSKRYGFIYVDRNDDGSGSLARYKKKSFAWYKSVIESNGAALYK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacttatacatttccaaaagactttctctggggtggtgcaacagctgccaatcagttt
gaaggtgcttacaacctagatggcaaaggtttgtctgtacaggatgtgacgccaaagggc
ggtgttccacttgaacctggggctttggatcctttgattacagaccaaccaacaccagat
aatctaaagctagaaggtatagatttctatcaccgttataaagaggacatagcacttttt
gcagagatgggcttcaaggtctttcgtatgtcaattgcatggtctcgtattttcccaaat
ggtgatgatgctgagccaaatgaagctggcctagccttctatgataaagtctttgatgaa
ttggctaagtatggcatcgaaccacttgtaaccttgtctcactatgaaacacctctcaac
ttggcgcgtgaatacaatggatggactaatcgtaaattgattggtttttatgaaaactat
gtccgtacagtcttcacacgctataaagataaggtcaaatattggttgacctttaatgaa
gtgaactctgttctacatgcaccattcatgtcaggtggtattgcgacacctatggaagag
ctctctaaacaggatctctatcaggcagtccaccatgagttagtggcatcagcttcagca
accaagattggtcatgacatcaaccctgattttaagattggttgtatggttcttgccatg
ccagcttatgggatgacagcaaatcctttggatcagttggctgttcacgagtttgaaaat
caaaactatctcttctcagatatccatgcacgtgggaaatatccaaactatattaaacgc
tatttcaaagacaatggtattgaaatacaattcgctcctggagatgaagaaatcttgaag
aataccgttgattttatttcattctcttattatatgtctgtggcgaccgcccacaatcca
gaagactatacgattggtaaaggaaatattatgggtggtgttgaaaatccctaccttgag
aaatctgagtggggttgggcaattgacccaatcggtcttcgtcttgttttgaatgacttc
tatgatcgttatcaattgccattgtttattgtcgaaaatggtttgggtgccaaggatgtc
cttgttgacggtcctgatggtccaatagttgaagatgattatcgtattgattatcttcaa
aaacacttgattcaagttggtgaagctcttcaagatggtgtggagctttggggttatacg
acttggggaccaattgatttggtatcagcttcaacggctgaactcagtaaacgatatggc
ttcatctacgttgatcgtaatgatgatggtagtggtagcttggctcgctataagaaaaaa
tcatttgcttggtataagtctgttatcgaaagtaatggtgcagctctttacaaatag

DBGET integrated database retrieval system