KEGG   Streptococcus salivarius 57.I: Ssal_01556Help
Entry
Ssal_01556        CDS       T02088                                 

Gene name
otc
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00220  Arginine biosynthesis
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01130  Biosynthesis of antibiotics
stf01230  Biosynthesis of amino acids
Module
stf_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Ssal_01556 (otc)
Enzymes [BR:stf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Ssal_01556 (otc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AEJ53823
UniProt: F8HES0
Position
complement(1528074..1529054)
Genome map
AA seq 326 aa AA seqDB search
MTQAKSFLKEIDFTKQELEELIDLSIKFKQLKKERIPHKYLDGLNIALIFEKTSTRTRSA
FTVAGQDLGMNVTYLGAGDIQLGKKESVVDTAKVLGSMFDGIEYRGFKQEDVEDLAKYSG
VPVWNGLTDTWHPTQMIADFMTLKERFGSLEGLTIAYIGDGRNNMANSLLVTSAILGVNV
KIIAPEVLQPEDEIVALAQKHNNGADLTITDDISEVKGVDMLYTDVWVSMGEEVDFKSRI
DLLLPYQINADLLAKTENPDVIVMHCLPAFHDLNTQIGKEIYDKYGLAELEITDQVFQKY
SDIIFQEAENRMHSIKAIMYNSLKNI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctaaatcatttttgaaagaaatcgactttaccaagcaggaacttgaggag
ttaatcgatttatctataaaatttaaacagctaaagaaggaaagaattccgcataaatat
ttagatggcttaaatattgccctgatttttgaaaaaacatctacaagaacccgctcagct
tttacagtggctggtcaggacctaggtatgaatgtgacctaccttggtgctggagacatt
cagttaggtaaaaaggaatctgtagttgatacagccaaggtgcttggttctatgtttgat
ggaatcgaataccgtgggtttaagcaagaagatgtcgaggatttggctaagtactcagga
gttccggtctggaatggtttgacggatacctggcatccaacgcaaatgattgcggatttc
atgactttgaaggagcgttttggtagtttggaaggcttgaccatcgcctatattggagat
ggtagaaataatatggccaactcacttttggtcacttcggctattttaggcgttaatgtc
aagattattgccccagaggtgctgcaacccgaagatgagattgtagccctagctcagaaa
cataataatggtgccgatttaaccattacagatgatatttcagaggtcaagggagtggat
atgctttatacggatgtctgggtatctatgggtgaagaagtagactttaaatctcgtatt
gatttactcttgccttatcaaattaatgcagacctacttgccaagacggaaaatccagat
gtcatcgttatgcactgtctcccagcctttcatgatctcaatacccaaattgggaaagaa
atctatgacaaatacggtttggcagagttagaaatcaccgatcaagtcttccaaaaatac
agtgatatcatcttccaagaagctgagaatcgtatgcattctatcaaggccattatgtac
aattccttgaaaaatatttaa

DBGET integrated database retrieval system