KEGG   Streptococcus salivarius 57.I: Ssal_01675Help
Entry
Ssal_01675        CDS       T02088                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00051  Fructose and mannose metabolism
stf00562  Inositol phosphate metabolism
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
stf01200  Carbon metabolism
stf01230  Biosynthesis of amino acids
Module
stf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01675 (tpiA)
   00051 Fructose and mannose metabolism
    Ssal_01675 (tpiA)
   00562 Inositol phosphate metabolism
    Ssal_01675 (tpiA)
Enzymes [BR:stf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ssal_01675 (tpiA)
Exosome [BR:stf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ssal_01675 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ssal_01675 (tpiA)
  Exosomal proteins of melanoma cells
   Ssal_01675 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEJ53933
UniProt: F8HFA5
Position
complement(1646118..1646876)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPAVDLTAVLAAAKGSNL
KVAAQNTYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcattcgttgaagctgtagcatcaaaacttccttcatcagatcttgttgaagctggt
atcgcagctcctgcagttgacttgacagctgtacttgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaatgctggtgccttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgtcgt
gactacttccacgaaactgatgaagacatcaacaaaaaagcaaaagcaatctttgctaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctcttgctggattgactgcagaacaagtc
gcttcaacagtaatcgcctacgaaccaatctgggctatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagttgctgacaaagtacgtgtccaatacggtggatcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagacgttgacggagctcttgtaggtggtgcatcacttgaa
gctgaaagcttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system