KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0794Help
Entry
MGAS15252_0794    CDS       T01794                                 

Definition
(GenBank) NagD-like phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00627  Aminobenzoate degradation
stg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MGAS15252_0794
Enzymes [BR:stg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     MGAS15252_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AFC66140
Structure
PDB: 

Position
776396..777160
Genome map
AA seq 254 aa AA seqDB search
MPYKGYLIDLDGTIYQGKNRIPAGERFIKRLQERGIPYLLVTNNTTRTPEMVQSMLANQF
HVETSIETIYTATMATVDYMNDMNRGKTAYVIGETGLKSAIAAAGYVEELENPAYVVVGL
DSQMTYEMLAIATLAIQKGALFIGTNPDLNIPTERGLMPGAGALNALLEAATRVKPVFIG
KPNAIIMNKSLEVLGIQRSEAVMVGDNYLTDIMAGIQNDIATILVTTGFTRPEEVPTLPI
QPDHVLSSLDEWRL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgccttataagggttatttaattgatttagacggaacgatttaccaagggaaaaaccgt
attccagcaggggagcggtttatcaaacgcctacaagaaagaggcattccctatttatta
gtgactaataataccacaagaacacccgaaatggtgcaaagcatgctggctaatcagttt
catgttgagacaagcattgagaccatttatacggctaccatggcaaccgtcgattacatg
aatgacatgaaccgtggtaagacagcttacgttattggagaaacagggctcaaatcagct
attgcagcagcaggttacgtagaagaacttgagaatcccgcttacgtggtggttggttta
gacagtcagatgacctatgagatgttggctatagccaccttagctattcaaaaaggtgcc
ctctttattgggacaaatcctgatttaaacatcccgactgaacgtggtttgatgccagga
gcaggtgcattgaatgccttactagaagctgccacacgtgtaaaacctgtttttattggc
aagcccaacgctatcatcatgaataaatcactagaggtattgggcattcagcgctctgaa
gccgtcatggttggcgataattacttgactgatatcatggcaggtattcaaaatgatatt
gcaacgatcctcgtgacaacaggctttaccagacctgaagaggtaccaaccttaccaatt
cagccagatcatgtcctatctagtcttgatgagtggaggttgtga

DBGET integrated database retrieval system