KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1115Help
Entry
MGAS15252_1115    CDS       T01794                                 

Definition
(GenBank) trans-isoprenyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00900  Terpenoid backbone biosynthesis
stg01100  Metabolic pathways
stg01110  Biosynthesis of secondary metabolites
Module
stg_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:stg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS15252_1115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:stg01006]
    MGAS15252_1115
Enzymes [BR:stg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     MGAS15252_1115
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     MGAS15252_1115
    2.5.1.29  geranylgeranyl diphosphate synthase
     MGAS15252_1115
Prenyltransferases [BR:stg01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   MGAS15252_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AFC66452
Position
complement(1108457..1109329)
Genome map
AA seq 290 aa AA seqDB search
MDKLARIDEAIRRYYKTTSNGVSEELIDAILYSVDSGGKRIRPLILLEMIEGFGVSLQNA
HFDLAAALEMIHTGSLIHDDLPAMDNDDYRRGRLTNHKQFGEATAILAGDSLFLDPFGLI
AQAELNSEVKVALIQELSLASGTFGMVGGQMLDMKGENQALSLPQLSLIHLNKTGKLLTF
PFKAAALVTEQAITVRQQLEQAGMLIGHAFQIRDDILDVTASFEDLGKTPKKDLFAEKAT
YPSLLGLEASYQLLTESLDQALTIFRTLESDVGFKPQIITKLIEGLRLNA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattagctagaattgacgaagccattcgtcgctactataagacgactagtaac
ggtgtatctgaagagttgattgatgctatcttgtattctgttgacagtggtggcaagcgc
attcgcccacttatcttattagagatgattgagggatttggggtatcgttacagaatgct
cattttgatttggctgcagcccttgaaatgattcatacaggaagtctgattcacgatgat
ttgccagccatggataatgatgattaccgacgtggtagactgaccaatcacaaacaattt
ggagaggctactgctattttggcgggagatagcttatttttagacccctttgggttaata
gctcaagctgaattaaatagcgaggttaaagtagccttaatccaagaactttccctagct
tcaggaacttttggcatggttggtggtcagatgctagatatgaaaggggaaaatcaagct
ttgagtctccctcagttgtcactgattcacctcaataaaaccggaaaattattaactttt
ccttttaaagcagcagctcttgtaacagaacaggctattactgttcgtcaacaactagag
caggcgggaatgctcatcgggcacgcctttcagattagggatgatattttagacgtgaca
gctagctttgaagatcttggaaaaacgcctaaaaaggatttatttgcagaaaaagctact
tacccaagtttattggggttagaagcctcctaccaactgttgacagagagtttagatcag
gctttgacgatttttcggacactcgaaagcgatgtaggctttaagcctcaaataattaca
aaactgatagaagggttacgacttaatgcctaa

DBGET integrated database retrieval system