KEGG   Symbiobacterium thermophilum: STH115
Entry
STH115            CDS       T00196                                 

Name
(GenBank) pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00620  Pyruvate metabolism
sth00640  Propanoate metabolism
sth00650  Butanoate metabolism
sth01100  Metabolic pathways
sth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STH115
   00640 Propanoate metabolism
    STH115
   00650 Butanoate metabolism
    STH115
Enzymes [BR:sth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     STH115
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: BAD39100
UniProt: Q67T93
Position
complement(134277..136505)
AA seq 742 aa
MTAWRGFRPGRWQRHIDTRDFIQQNYRPYEGDASFLSGPTQRTKALWEKVFAIFREEQAK
RAPLKVDTQTPAGILSHRPGYVDRDLELIVGLQTDEPGKRTFYPAGGWRMVESSMKAYGY
EADPQWKTIYTQYRKTHNQGVFDAYTPEMRAARSNHIITGLPDAYGRGRIIGDYRRVALY
GIDRLIEEKEREKAATEPWVMDEPTIRLREELTEQINALHELKELGRWYGLDLGRPAENA
REAIQWLYMGYLGAIREQNGAAMSIGRISTFLDIYIERDLESGLLTEAQAQELVDQLIIK
LRQVAFLRTPEYNELFSGDPTWVTESIGGMGLDGRTLVTRTSFRFLQTLYNLGPAPEPNL
TVLWSTRLPEGFKKFCAQVSIDTSAIQYENDDIMRPLWGDDYGIACCVSAMRIGKQRQFF
GARANLAKCLLYAINGGVDEKSGQQVGPRLQPITSDVLDYEEVRARFSEMMDWLARLYIN
TLNIIHYMHDKYNYEWLEFALHDRDIYRTMACGIAGLSVVADSLSAIKHARVRPVRDERG
IAVDFEIEGEYPAYGNNDDRVDSIAREVVEEFTARLRKNKAYRDADITLSVLTITSNVVY
GKHTGTTPDGRKAGVPLAPGANPMHGRDRKGAIASLTSVAKIPYEAAKDGISNTFSIVPK
ALGRTREDQRRNLVAILDAYTSQGAHHLNVNCLSRETLLDAMEHPELYPQLTVRVSGYAV
NFVKLTREQQLDVISRTFHQSL
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaccgcgtggcgtggattccgtcccggccgctggcagcggcatatcgatacccgcgac
ttcatccagcagaactaccgcccttatgagggcgatgcttccttcctcagcggcccgacc
caacggaccaaggccctatgggagaaggtgttcgccatcttcagggaggagcaggccaag
cgggctccgctgaaggtggacacccagactcccgctgggatcctgtcgcacaggccgggg
tacgtggaccgggacctggagctgatcgtcggcctgcagaccgacgagcccggcaagcgg
acgttctaccctgccggcggctggcgcatggtcgagtcctcgatgaaggcctacggctac
gaggccgacccccagtggaagaccatctacacccagtaccgcaagacccacaaccagggc
gtgtttgacgcgtacacccccgagatgcgcgccgcccgctccaaccacatcatcaccggc
ctgcccgacgcctacggccgcggccgcatcatcggcgactaccgccgggtggcgctttac
ggcatcgaccggctcatcgaagagaaggagcgggagaaggccgccaccgagccctgggtc
atggatgaacccaccatccggctccgggaggagctgacggagcagatcaacgcgctgcac
gagttgaaggagctgggccgctggtacggcctggacctcggccgccccgcggagaacgcc
cgggaggcgatccagtggctctacatgggctacctgggcgcgatccgggaacagaacggc
gccgccatgtccatcggccggatctccaccttcctcgacatctacatcgagcgggacctg
gagtcgggcctccttaccgaggcgcaggcccaggagctggtggaccagctcatcatcaag
ctgcgccaggtcgccttcctgcgcacgccggagtacaacgagctcttcagcggggatccc
acctgggtgaccgagtccatcggcggcatggggctggacggccgcaccctggtcacccgg
acctcgttccggttcctgcagacgctctacaacctgggcccggcgccggagcccaacctg
acggtgctctggtccacccggttgcccgaggggttcaagaagttctgcgcgcaggtctcc
atcgacacgtcggcgatccagtacgagaacgacgacatcatgcggccgctgtggggcgac
gactacggcatcgcctgctgcgtctcggccatgcggatcggcaagcagaggcagttcttc
ggcgcccgggccaacctggccaagtgcctgctctacgccattaacggcggcgtcgacgag
aagtcgggccagcaggtgggcccccggctgcagcccatcaccagcgacgtgctcgactac
gaggaagtgcgggcccgcttcagcgagatgatggactggctggcgcggctgtacatcaac
acgctcaacatcatccactacatgcacgacaagtacaactacgagtggctggagttcgcc
ctgcacgaccgtgacatctaccgcaccatggcctgcggcatcgcggggctctcggtggtg
gcggactccctctcggcgatcaagcacgccagggtccggcccgtgcgcgacgagcggggc
atcgcggtggacttcgagatcgagggcgagtacccggcctatggcaacaacgacgaccgg
gtggactccatcgcccgcgaggtggtggaagagttcaccgcgcggctgcggaagaacaag
gcctaccgggatgccgatatcaccctgtccgtgctgacgatcacctccaacgtggtgtac
ggcaagcacaccggcaccaccccggacggccggaaggccggcgtgcctctggctcccggc
gccaaccccatgcacgggcgcgaccggaagggggcgatcgcctcgctcacctccgtggcc
aagatcccctatgaggcggccaaggacggcatctccaacaccttctccatcgtgccgaag
gctctgggccggacccgggaggatcagcggcgcaatctggtggccatcctggacgcctac
accagccagggcgcgcaccacctgaacgtcaactgcctcagccgtgagaccctgctggat
gccatggagcatccggagctctacccgcagctcaccgtccgggtctcgggctacgccgtg
aacttcgtgaagctgacgcgcgagcagcagctcgacgtgatcagccgcacgttccaccag
agtctgtga

DBGET integrated database retrieval system