KEGG   Symbiobacterium thermophilum: STH188Help
Entry
STH188            CDS       T00196                                 

Definition
(GenBank) sugar isomerase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00051  Fructose and mannose metabolism
sth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STH188
Enzymes [BR:sth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     STH188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: BAD39173
UniProt: Q67T20
Position
213416..214708
Genome map
AA seq 430 aa AA seqDB search
MAVYRAQGVWPGEAEGRIVWVDPEWQPERAGCADRPAEIGRLREAVGRALHDLDAWMDRQ
PTLGGRVLLQHCREALQDPAFMERVTMLIDQHGLTAPAALMEAASLVGGIMARSEELRER
AAALRQTARWLARRLDGAAHPEDAILASRAFSALELLDRTRPAVMAAGEPVVVGDAPLLW
GVDAVAPEWAGRPARIRGGTLILGEEDEAGGLLHEAARRAVLAVARRMKAEGLVRMKEGN
VSCRIPGTSLFAVTPSGLPYESLEPADICILDLDGRVVDARRRPSTETALHRFVYRRRPD
VGGVVHTHSLHATAFACTGREIPVISTELAALVGAEVPCAPYAPAGTERLAEVVAEALGD
EGAAALLQNHGVVTVGETVEQAYAAAVAVEVAAQVFLLARQLGEPIVLPPEERRRIFRSM
RTGYGQPREA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttaccgtgcgcagggggtatggcccggagaggctgaaggccgcatcgtctgg
gtggatccggagtggcagccggagcgggccgggtgcgcggacaggcccgcggagatcggg
cggctgcgggaggcggtcggccgcgcgctgcacgacctggacgcctggatggaccggcag
ccgaccctcggggggcgggtgctgctgcagcactgccgcgaggcccttcaggacccggcc
ttcatggagcgggtcaccatgctgatcgaccagcacggcctgacggccccggccgcgctg
atggaggcggcttccctggtgggcggcatcatggcccgcagcgaagagctgcgggagcgg
gcggcagccttgcggcagacggcccgctggctcgcccgtcggctggacggcgccgcgcac
cccgaggatgccatcctcgcgagccgcgccttctcggcgctggagctcctcgaccgcacg
cggccggccgtgatggccgccggcgagccggtggtggtgggcgacgcgccgctgctctgg
ggcgtggacgcggtggcgccggagtgggccggcaggccggcccggatccgcggcggcacg
ctgatcctcggcgaggaggacgaggccggcggcctcctgcacgaggccgcgcggcgggcg
gtcctggccgttgcccgccgcatgaaggcggaggggttggtgcggatgaaggagggcaac
gtctcctgccgcatcccgggaacctccctgttcgcggtcacccccagcggcctgccctac
gaatcgctggaaccggcggacatctgcatcctggacctggacggacgggtggtggacgcg
cggcggcggccctccacggaaacggctctgcaccggtttgtctaccggcggcgtccggac
gtgggcggggtggtgcacacccactccctccacgcgacggcctttgcctgcaccgggcgg
gagatccccgtgatctccacggagctggccgcgctggtgggggcggaggtcccctgtgcg
ccgtacgcccccgccggcacggagcggctcgcggaggtggtcgcggaggccctgggcgac
gagggcgccgccgcgctgctgcagaaccacggcgttgtcacggtcggggagacggtggag
caggcctacgcggccgcggtggcggtggaggtggccgcgcaggtcttcctgctggcgcgg
cagttgggggagccgatcgttcttccgccggaggagcgtcgacgcatcttccgctccatg
cgcaccggctacgggcagccccgggaggcatag

DBGET integrated database retrieval system