KEGG   Symbiobacterium thermophilum: STH212Help
Entry
STH212            CDS       T00196                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00071  Fatty acid degradation
sth00280  Valine, leucine and isoleucine degradation
sth00281  Geraniol degradation
sth00310  Lysine degradation
sth00360  Phenylalanine metabolism
sth00362  Benzoate degradation
sth00380  Tryptophan metabolism
sth00410  beta-Alanine metabolism
sth00640  Propanoate metabolism
sth00650  Butanoate metabolism
sth00903  Limonene and pinene degradation
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01130  Biosynthesis of antibiotics
sth01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STH212
   00650 Butanoate metabolism
    STH212
  Lipid metabolism
   00071 Fatty acid degradation
    STH212
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STH212
   00310 Lysine degradation
    STH212
   00360 Phenylalanine metabolism
    STH212
   00380 Tryptophan metabolism
    STH212
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STH212
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STH212
   00281 Geraniol degradation
    STH212
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STH212
   00627 Aminobenzoate degradation
    STH212
   00930 Caprolactam degradation
    STH212
Enzymes [BR:sth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STH212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 DUF3046
Motif
Other DBs
NCBI-ProteinID: BAD39197
UniProt: Q67SZ6
Position
236506..237279
Genome map
AA seq 257 aa AA seqDB search
MAYENILVFREGAVGRVQLNRPQALNALNFRLMTELVEAFREMERDPGIGCLLLHGNEKA
FAAGADIKEMAELGAIDMYTRDYIELWDEVARIKKPIVAAVSGYCLGGGLELAMICDIIV
ASETAKFGQPEINIGVLPGAGGTQRLTRAVGKSLAMEMVLTGRMLTAQEALAAGLVSRVV
PVEVYLSEAQKLAGEIASKSPVALRLAKEAVLQAFEGSLSSGLAYERRLFAMAFASEDQK
EGMRAFTEKRKPEWKGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtacgagaacatcctggtctttcgtgagggagctgtcggccgggtgcagctgaac
cgcccccaggcgctcaacgccctcaacttccgcctgatgacggagctggtggaggcgttc
cgggagatggagcgcgatccgggcatcgggtgcctcctgctgcacggcaatgagaaggcc
ttcgccgccggcgccgacatcaaggagatggcggagctgggcgcaatcgacatgtacacc
cgggactacatcgaactctgggatgaagtcgcccgcatcaagaagcccatcgtcgctgcc
gtcagcggctactgcctgggcggcggcctggagctggcgatgatctgcgacatcatcgtc
gcctcggagacggcgaagttcggccagccggagatcaacatcggcgtcctgccgggcgcc
ggcggcacccagcggctcacccgggcggtcgggaagtcgctggcgatggagatggtcctg
accggccggatgctcaccgcgcaggaggccctggcggccggtctggtcagtcgggtggtt
ccggtggaggtctacctcagcgaggcgcagaagctggccggcgagatcgcgtccaagtcg
cccgtggccctgcggctggccaaggaggcggtgctgcaggccttcgagggcagcctgagc
agcggactcgcgtacgagcgccggctgttcgccatggcttttgcctccgaggaccagaag
gagggcatgcgggccttcaccgagaagcggaagcccgagtggaaggggaggtaa

DBGET integrated database retrieval system