KEGG   Symbiobacterium thermophilum: STH244Help
Entry
STH244            CDS       T00196                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00010  Glycolysis / Gluconeogenesis
sth00051  Fructose and mannose metabolism
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01130  Biosynthesis of antibiotics
sth01200  Carbon metabolism
sth01230  Biosynthesis of amino acids
Module
sth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sth_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH244
   00051 Fructose and mannose metabolism
    STH244
   00562 Inositol phosphate metabolism
    STH244
Enzymes [BR:sth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STH244
Exosome [BR:sth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STH244
  Exosomal proteins of bladder cancer cells
   STH244
  Exosomal proteins of melanoma cells
   STH244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAD39229
UniProt: Q67SW4
Position
270705..271475
Genome map
AA seq 256 aa AA seqDB search
MRTPIVAANWKMHKTQPEARQFLADFLPREAGMSGVEIVICPPFTALAAVAGGLTGTRVG
LGAQNMSDKPSGAFTGEVSGAMLVDAGCRYVILGHSERRRLFGESDEVVGAKVRAALQHG
LIPILCIGETLEEQQAGEADAVNRRQLLAGLEGLTPEQVANLVIAYEPVWAIGTGRNCDP
GDAQARIAAVRAVVAEAFGPEAAARVRIQYGGSVKPENMAAYMAQPDIDGALVGGASLDP
TSFAAICAAAAEARAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcggacccccatcgttgcggccaactggaagatgcacaagacgcagcctgaggcccgg
cagttcctcgccgatttcctgccccgggaagccggtatgtccggggtggagatcgtcatc
tgcccgcccttcaccgcgctggccgcggtggccggggggctcacgggcacccgggtcggg
ctgggcgcgcagaacatgagcgacaagccctccggagccttcaccggcgaggtctcgggc
gcgatgctggtggacgccggctgccggtacgtgatcctcggccactcggagcggaggcgg
ctgttcggggagagcgacgaggtggtcggcgccaaggtgcgcgccgccctgcagcacggg
ctgatccccatcctctgcatcggggagacgctggaggagcagcaggccggcgaggcggat
gccgtcaaccggcggcagctcctggcgggcctggaggggctgactcccgagcaggtggcg
aacctcgtcatcgcgtacgaaccggtctgggccatcggcaccggccggaactgcgacccc
ggcgacgcccaggcgcgcatcgccgcggtgcgggcggtggtggccgaggccttcgggccg
gaggccgccgcgcgcgtgcgcatccagtacggcggctccgtaaagccggagaacatggcg
gcctacatggcccagccggatatcgacggcgccctggtcggcggcgccagcctggacccg
acctcgttcgccgcgatctgcgcggccgccgccgaggcccgggcccggtga

DBGET integrated database retrieval system