KEGG   Symbiobacterium thermophilum: STH2741Help
Entry
STH2741           CDS       T00196                                 

Definition
(GenBank) 1-pyrroline-5 carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00250  Alanine, aspartate and glutamate metabolism
sth00330  Arginine and proline metabolism
sth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STH2741
   00330 Arginine and proline metabolism
    STH2741
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     STH2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh zf-3CxxC
Motif
Other DBs
NCBI-ProteinID: BAD41726
UniProt: Q67KS1
Position
complement(2946781..2948343)
Genome map
AA seq 520 aa AA seqDB search
MAVVPFQNEPLTDFSLPQNREAFRRALELVQSRFGREYPLIIGGERIMTRDRILSTNPAN
PKEVIGSVAKADRDLADKAMAAALAAFQDWSRVSPKARARILLKAAAIMRRRKHEFSATM
VVEIGKSWVEADADTAEAIDFLEYYAREMYRLSEPQPLTRIPGEDNELYYIPLGVGLIIP
PWNFPCAITVGMTASAIVAGNTVILKPSSLTPVVAALFAEVMEEAGLPPGVLNYLPGPGG
SVGDYLVGHPQTRFISFTGSKEVGLRINEVAAKTAPGQRWIKRVVAEMGGKDAIVVDREA
DLDAAADGIVASAYGFQGQKCSACSRAIIHQDVYEEMIERIVERTKKLVQGDPRDPEVHQ
GPVADESAFKSILHYIEIGKQEGRLVLGGGPSPLASETGGYFIQPTIFADVDSRARIGQE
EIFGPVLAIMKAKDFEDAIRIANDTEYGLTGSVYSRNRANLEYARRHFFVGNLYLNRKST
GALVGVHPFGGFNMSGTDSKTGGHDYLLLFLQAKAVSEKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgtgcccttccagaacgagccgttgaccgacttctcgctgccgcagaaccgc
gaggccttccggcgtgccctggagctggtgcagagccgcttcggccgggagtacccgctg
atcatcggcggggagcggatcatgacgcgggatcggatcctgtccaccaatccggccaac
cccaaagaggtcatcggttcggtggccaaggccgaccgggatctggcggacaaggccatg
gccgccgccctcgcggcgttccaggattggagccgggtgagcccgaaggcgcgggcgcgg
atcctcctgaaggccgcagccatcatgcgccgccggaagcacgagttctcggcgaccatg
gtggtggagatcggcaagagctgggtcgaggccgacgccgacaccgcggaggcgatcgac
ttcctggagtactacgcccgcgagatgtaccggctgtccgagccgcagccgctcacccgg
attcccggcgaggacaacgagctctactacatcccgctgggcgtcgggctgatcatcccg
ccctggaacttcccgtgcgccatcacggtgggcatgaccgcctcggccatcgtcgccggc
aacaccgtcatcctgaagccctcgtcgctcaccccggtcgtggcggcgctcttcgccgag
gtgatggaagaggccggcctgccgcccggcgtgctcaactacctgccgggtcccggcggc
tcggtgggcgactacctggtgggccacccgcagacccggttcatcagcttcaccggctcg
aaggaggtcggcctgcgcatcaacgaggtcgcggcgaagaccgcgcccggtcagcgctgg
atcaagcgggtcgtcgccgagatgggcggcaaggacgccatcgtggtggaccgggaggcc
gacctggatgccgcagcggacgggatcgtggcctcggcctacggcttccaggggcagaag
tgctccgcctgctcccgcgcgatcatccaccaggacgtctacgaagagatgatcgagcgc
atcgtggagcgcacgaagaagctggtgcagggcgatccgcgcgatccggaggtccaccag
ggtcccgtggccgacgaatcggcgttcaagtccatcctccactacatcgagatcggcaag
caggagggtcggctggtgctgggcggcggcccgtccccgctggcgtccgagaccggcggc
tacttcatccagccgaccatcttcgccgacgtggattccagggcccgcatcggccaggag
gagatcttcggtccggtgctggcgatcatgaaggcgaaggatttcgaggatgccatccgc
atcgccaacgacaccgagtacggcctcaccgggtccgtctactcccgcaaccgggccaac
ctggagtacgcacggcgccacttcttcgtgggaaacctctacctcaaccgcaagtccacc
ggcgccctggtgggggtgcaccccttcggcggcttcaacatgagcggcaccgactccaag
accggcggacacgactacctgctgctcttcctgcaggccaaggcggtcagcgagaagctg
tag

DBGET integrated database retrieval system