KEGG   Symbiobacterium thermophilum: STH344Help
Entry
STH344            CDS       T00196                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STH344
Enzymes [BR:sth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     STH344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAD39329
UniProt: Q67SL4
Position
381867..382460
Genome map
AA seq 197 aa AA seqDB search
MSQKRLVLATKNQGKVREFRSLLAGAGFEIVGLDPDAPEVSETGDTFEENALIKARAASA
LTGLPALAEDSGIVVDALGGEPGVHSARWVPGSDEDRVRALLARMAEVPAERRTARYVSV
IAVVLPSGREELFRGELEGRLAEAPRGTGGFGYDPIFVVADGRTVAEMALEEKNGISHRS
RALARCLERLPALLEEG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacagaagcgtctggtattggccaccaagaaccaggggaaggtgcgggagtttcgc
tcgctcctggcgggggcgggctttgagatcgtcgggctggatccggatgcaccggaggtc
agcgagacgggggatacctttgaggagaacgccctgatcaaggcgcgggcggcgtccgcc
ttgacggggcttcccgccctcgcggaggactcgggcatcgtggtggacgccctgggcggc
gagcccggggtgcactccgcccgctgggtgcccggaagcgacgaggaccgggtgcgcgct
ctgctggcacggatggcggaggtgcccgcggaacggcggaccgcccgctacgtgtcggtg
atcgcggtggtactgccgtcggggagggaggagctcttccggggcgagctggaaggccgg
ttggccgaggcgccccggggcaccggcggattcggttacgatccgatctttgtggtggcg
gacgggaggaccgtcgcggagatggccctggaggagaagaacgggatcagccaccgttcc
cgggcgctggcccgctgcctggagcggctgcccgccctgctggaggagggttag

DBGET integrated database retrieval system