KEGG   Symbiobacterium thermophilum: STH413Help
Entry
STH413            CDS       T00196                                 

Definition
(GenBank) pyruvate dehydrogenase E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00010  Glycolysis / Gluconeogenesis
sth00020  Citrate cycle (TCA cycle)
sth00620  Pyruvate metabolism
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01130  Biosynthesis of antibiotics
sth01200  Carbon metabolism
Module
sth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH413
   00020 Citrate cycle (TCA cycle)
    STH413
   00620 Pyruvate metabolism
    STH413
Enzymes [BR:sth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STH413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N NQRA GCV_H
Motif
Other DBs
NCBI-ProteinID: BAD39398
UniProt: Q67SE5
Position
448748..450100
Genome map
AA seq 450 aa AA seqDB search
MAYEFKLPDVGEGLHEAELLRWLVKEGDTVTEDQPIMEVQTDKATVEITSPVNGRVVKLL
GQPGDILKVHSVVVIFDDGSPGALPTAGEVASGVAAAAPAGAQPQASLDVPAPAAQPAPA
PAAPPAPAPAPAAGAGPADRPRRALATPATRRLARELGVDINQVPGTGPAGRVTSDDVRA
FAARRTAPAPAQAPTQAPTEAAAPTPATPAPAAPAEADDERIPLRGIRKVIAERMVKSKY
TAPHVTTVEEVDMTELMAFRAQAKELAARKGIKLSFMPFIIKAVVAALREFPYLNASIDD
EAQEIVLHKRYHIGFALDTDAGLLVPVIKDADRKPVFAIAQEMNDLIARGREGKLAPDEM
RGSTFTISNQGSIGGLFFTPVINYPEVAILGIGKTQPRPVVRDGEIVIRQMAHLALSFDH
RLIDGGMATRFLNRLAELLSDPTLLMMEAM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaattcaagctgcccgacgtgggcgaggggctgcacgaagcggaactcctg
cgctggctggtgaaggagggcgacaccgtcaccgaggaccagccgatcatggaggtgcag
accgacaaggctacagtggagatcacctccccggtcaacggccgggtggtcaagctgctg
ggccagccgggcgacattctgaaggtccacagcgtcgtcgtcatcttcgatgacggttcg
ccgggcgcgctgccgacggccggtgaggtcgcctccggcgtggccgcagccgcgccggcc
ggggcgcagccgcaggcgtcgctggacgtgccggcaccggccgcgcagcccgctcccgcc
ccggccgcgccgcccgctcccgccccggccccggcggctggcgccgggcctgcggaccgg
ccgcggcgcgccctggccaccccggccacccgacggctggcccgggagctgggggtcgac
atcaaccaggtgcccggcaccggccctgcggggcgcgtgaccagtgacgatgtccgggcc
ttcgccgcacggcggaccgcgcctgcccctgcgcaggccccgacccaggctcccaccgaa
gcggctgcccccaccccggctacccccgccccggctgcccctgcggaggcggacgacgag
cgcatcccgctgcggggcatccggaaggtcattgccgaacggatggtgaagtcgaaatat
acggctccgcacgttacgaccgtagaagaggtggatatgacggagctgatggcgttccgc
gcccaggccaaggagctggccgcgcggaagggcatcaagctgtcgttcatgccgttcatc
atcaaggcggtcgtcgccgccctgcgggagttcccgtatctcaacgcctccatcgacgac
gaggcgcaggagatcgtcctgcacaagcgctaccacatcggcttcgcgctggacacggac
gccggcctgctggtgcccgtgatcaaggacgccgaccggaagccggttttcgccatcgca
caggagatgaacgacctgatcgcccgcgggcgggaggggaagctggcgccggacgagatg
cggggctccacgttcaccatctccaaccagggctccatcggcggcctgttcttcactccg
gtgatcaactaccccgaggtggcgatcctcggcatcgggaagacccagccgcggccggtg
gtgcgggacggcgagatcgtcatccggcagatggcgcacctggcgctttccttcgatcac
cggctgatcgacggcggcatggccacccgcttcctgaaccgcctcgcggagctgctcagc
gatccaaccctgctcatgatggaggcgatgtaa

DBGET integrated database retrieval system