KEGG   Symbiobacterium thermophilum: STH442
Entry
STH442            CDS       T00196                                 

Symbol
tnaT
Name
(GenBank) sodium- and chloride-dependent transporter, TnaT
  KO
K03308  neurotransmitter:Na+ symporter, NSS family
Organism
sth  Symbiobacterium thermophilum
Brite
KEGG Orthology (KO) [BR:sth00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    STH442 (tnaT)
SSDB
Motif
Pfam: SNF DUF5862
Other DBs
NCBI-ProteinID: BAD39427
UniProt: Q67SB6
Position
478796..480301
AA seq 501 aa
MEAQRDQWKSRSGFIFATIGAAVGLGNFWRFPFMAYQNGGGAFLLPYFVALLTAGVPLMI
LEFGFGHKMRTATITAFKKLNRRFEWIGWWQITVPVVVVTFYSVIISWSLRYLIFSFTQA
WGDDPGTFFSSDFLGITSGPLELGGLRWGIFAAVAVVWFANYYISAQGISGGIEKACKIM
TPFLIVAMLIFVIRGITLPGATYGLNYFLNPDFSKIMDPGVWVAAYSQVFFSTTLAVGVM
IAYASYVPEDSDLANNAFITVFANSSFDFMAGLAVFSTLGYAAVTAGVPFEEMAVAGPGV
AFVAFPKAISMLPGPTWLQSLFGILFFSALLLAGISSSISQMESFASAVIDRFGVDRKKL
LGWFSLIGFAFSALFATGAGVHILDIVDHFVGSYAIAILGLVEAIVLGYIMGTARIREHV
NLTSDIRVGMWWDVLVKYVTPVLLGYNILSNFISEFREPYAGYPTGALVLFGWVVAIAMF
GTSLFMQWRSQQLDVTGGEVG
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaggcacagcgcgatcagtggaaatcccgatccggattcatcttcgccacgatcggt
gctgccgtggggctggggaacttctggcgtttcccgttcatggcgtatcagaacggcggc
ggggcgttcctgcttccctacttcgtggccctgctcacggccggcgtccccctgatgatc
ctggagttcggcttcggccacaagatgcgcaccgcgacgatcaccgccttcaaaaagctg
aaccggcggttcgagtggatcggctggtggcagatcaccgtccccgtggtcgtcgtgacg
ttctacagcgtgatcatctcctggtcgctccgctacctcatcttcagctttacccaggcc
tggggtgacgatccggggaccttcttcagcagcgacttcctggggattacctccggcccc
ctggagctgggcggcctgcgctgggggatcttcgccgccgtcgcggtggtctggttcgcc
aactactacatctccgcgcagggcatctccggcggcatcgagaaggcatgcaagatcatg
acgcccttcctcatcgtggcgatgctcatcttcgtcatccgcggcatcacgctgccgggc
gccacctacgggctcaactacttcctcaacccggacttcagcaagatcatggaccccggc
gtctgggtggccgcctacagccaggtcttcttctcgaccaccctggcggtgggcgtgatg
atcgcctatgccagctacgtgcctgaggactcggacctggccaacaacgccttcattacc
gtcttcgccaactcatcctttgacttcatggccggtctggcggtcttttcgaccctgggc
tacgcggcggtcaccgccggcgtgccgtttgaggagatggccgtggcaggtcccggcgtc
gccttcgtcgccttccccaaggccatttcgatgctgcccggtcccacctggctgcagtcg
ctgttcggtatcctgttcttctctgcactgctgcttgccggcatctcgtcctcgatctcg
cagatggaatccttcgcctcggcggtgatcgaccggttcggcgtggaccgcaagaagctg
ctgggctggttctccctcatcgggtttgccttcagcgccctgtttgccaccggcgccggc
gtgcacatcctcgacatcgtcgaccatttcgtgggcagctacgccatcgccatcctgggt
ctggtggaggccatcgtgctgggctatatcatgggcaccgccaggatccgggagcacgtg
aacctcacctccgacatccgggtcggcatgtggtgggacgtgctggtcaagtacgtcacc
ccggtgctcctgggttacaacatcctctccaacttcatcagcgagttccgggagccgtac
gccggctacccgaccggcgccctggtcctcttcggctgggtggtggccatcgccatgttc
ggcacttcgctgttcatgcagtggcgctcgcagcagcttgacgtgaccggcggggaggtg
ggctag

DBGET integrated database retrieval system