KEGG   Symbiobacterium thermophilum: STH720Help
Entry
STH720            CDS       T00196                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00071  Fatty acid degradation
sth00280  Valine, leucine and isoleucine degradation
sth00310  Lysine degradation
sth00362  Benzoate degradation
sth00380  Tryptophan metabolism
sth00620  Pyruvate metabolism
sth00630  Glyoxylate and dicarboxylate metabolism
sth00640  Propanoate metabolism
sth00650  Butanoate metabolism
sth00900  Terpenoid backbone biosynthesis
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01130  Biosynthesis of antibiotics
sth01200  Carbon metabolism
sth01212  Fatty acid metabolism
sth02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STH720
   00630 Glyoxylate and dicarboxylate metabolism
    STH720
   00640 Propanoate metabolism
    STH720
   00650 Butanoate metabolism
    STH720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STH720
   00072 Synthesis and degradation of ketone bodies
    STH720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STH720
   00310 Lysine degradation
    STH720
   00380 Tryptophan metabolism
    STH720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STH720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STH720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STH720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sth04147]
    STH720
Enzymes [BR:sth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STH720
Exosome [BR:sth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STH720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAD39705
UniProt: Q67RI8
Position
799413..800627
Genome map
AA seq 404 aa AA seqDB search
MAEAVIVDAVRTPIGRYGGALRDVRPDDLAAVVIRALLQRNPAVSPGSIDDVYLGCANQA
GEDNRNVARMAALLAGLPVTVPGVTVNRLCGSGLEAVAQAARAVWCGEGEVLVAGGTESM
TRAPFVMAKPAVPWARQVEVYDTTLGWRFVNPRLAERYPPISLGETAERVAERWNVTRED
QDRFAWQSQMRCAAAVREGRFDAEIVPVPVPGEDGRTELVVRDEHPRPDITLERLARLRP
VFRENGTVTAGNASGINDGASALLIMSGKRAAALGLVPMARIVATAVVGVDPSIMGMGPV
PATRKALQRAGLTVDQIDLVELNEAFAAQALACIRELGLDPARVNVNGGAIALGHPLGCS
GARILTTLVHEMVRRGSRYGLATMCIGVGQGIAMIVEAIRPKSA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggcagaagcggtgatcgtcgatgccgtgcgaacgcccatcggccgatacggcggcgcg
ctccgagatgtccggccggatgacctggccgcggtggtgatccgggcgctccttcagcgg
aaccccgcggtctccccggggagcatcgatgacgtctacctgggctgcgccaaccaggcc
ggcgaggacaaccgcaacgtcgcccgcatggcggcgctgctggccgggctgccggtgacg
gtgcccggggttacggtgaaccggctctgcggctcggggctggaggcggtggcccaggcg
gccagggcggtgtggtgcggggaaggagaggttctggtcgccggcggcacggagtcgatg
acccgggcgcctttcgtgatggccaagcccgctgtgccgtgggcccgccaggtggaggtc
tacgacaccaccctcgggtggcgcttcgtcaacccgcgcctcgcggagcggtacccgccc
atcagcctgggggagacggccgagagagtggctgaacggtggaacgtgacccgggaggac
caggacaggtttgcatggcaaagccagatgcggtgtgccgccgcagtgagggaagggcgt
ttcgacgcggagatcgttccggtgcccgtccccggcgaggatggacgcacagagttggtg
gtacgggacgagcacccgcggccggacatcacgctcgaacggctggccaggctcagaccc
gtcttccgggagaacgggacggtcacggccggaaacgccagcggcatcaacgacggagcc
tccgccctgctgatcatgtccgggaagcgggcggcggccctgggactggttcccatggcc
aggatcgtcgccaccgcggtggtcggcgtggacccgtcgatcatgggcatgggcccggtc
ccggcaacaagaaaggccctgcagcgggccggcctcacggtcgatcagatcgacctggtc
gagttgaatgaggcctttgccgcgcaggccctggcgtgcatccgggagctgggactggat
cccgcccgggtgaacgtgaacggcggggcgatagccctgggccatccgctggggtgcagc
ggggcccggatcctgacgacgctggtgcatgaaatggtccgcagaggcagccgctacggc
ctggccaccatgtgcatcggggtggggcaggggatcgccatgatcgttgaggccattcgc
ccaaagtccgcgtaa

DBGET integrated database retrieval system