KEGG   Streptococcus thermophilus ASCC 1275: T303_03635Help
Entry
T303_03635        CDS       T03360                                 

Definition
(GenBank) glycyl-tRNA synthase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
sthe  Streptococcus thermophilus ASCC 1275
Pathway
sthe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sthe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T303_03635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sthe01007]
    T303_03635
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sthe03016]
    T303_03635
Enzymes [BR:sthe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     T303_03635
Amino acid related enzymes [BR:sthe01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   T303_03635
Transfer RNA biogenesis [BR:sthe03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    T303_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AIC24041
Position
654743..656779
Genome map
AA seq 678 aa AA seqDB search
MTKNLLVELGLEELPAYVVTPSEKQLGEKMAAFLGENRLSYESIQTFSTPRRLAVRVLGL
ADQQTDLTEDFKGPSKKIALDADGNFSKAAQGFVRGKGLTVDDIEFREVKGEEYVYVTKH
EAGKSAKEVLAGIPEVLASLTFPVSMHWANNSFEYIRPVHTLIVLLGDEALELDFLGIKS
GRVSRGHRFLGHEVEITNADSYEEDLRTVYVIADSKERENMIREQIKAIEAEQGVQVQIE
EGLLNEVLNLVEYPTTFMGGFDTKYLDVPEDVLVTSMETHQRYFVVRDLDGRLKPNFISV
RNGNAEHLENVVRGNEKVLVARLEDGEFFWREDQKLKIEDLVAKLANVTFHEKIGSLSEH
MARAGVIAASLAEKAGLTAEEKAAVARAAEIYKFDLLTGMVGEFDELQGIMGEKYALLAG
EDEAVATAIREHYLPDSADGALPETKVGAILALADKLDTLLSFFSVGLIPSGSNDPYALR
RATQGIVRILDAFGWHIPMDELIDSLYGLSFDSLSYDNQAEVIRFIKARVDKMMGSTPKD
IKEAVLSGSNFVVADMLEAAEALSEAAKTDGYKAAVESLSRAFNLAEKADTSVAVDASLF
ENDQEKALAQAAESLELTGSASDKLAQLFVLSPVIDAFFDNTMVMADDVAVKNNRLALLS
ALVAKAKTVAAFNQLNTK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaacttattagtagaactaggacttgaagagttgccagcctacgtagtcaca
ccaagtgaaaaacaactgggtgagaaaatggcagctttcttgggtgaaaatcgcctttca
tatgaaagcattcaaaccttctcaacacctcgccgtttagcagttcgtgtacttggtttg
gctgatcaacaaaccgatttgacagaagattttaaaggaccttctaagaaaattgccttg
gatgctgatggaaacttctcaaaagctgcccaaggatttgttcgtgggaaaggcttgacg
gttgacgatattgaattccgtgaagtcaaaggggaagaatatgtctatgtgacgaaacat
gaagctggaaaatctgccaaagaagtattggctggtatcccagaagtacttgcttcattg
accttccccgtcagcatgcactgggctaacaacagctttgaatatattcgccctgttcac
acattgatcgttcttttgggggatgaagcccttgaattagactttttgggtattaagtca
ggtcgtgttagtcgtgggcaccgtttcctcgggcacgaagtggaaatcaccaatgcggat
tcttatgaagaagaccttcgtaccgtttacgtgattgcagatagtaaagagcgtgaaaac
atgattcgtgagcaaatcaaagctatcgaagcagaacaaggtgttcaagtccaaatcgaa
gaaggtcttttgaacgaagttttgaacttggtcgaatacccaactaccttcatgggaggt
tttgatactaaatatttggacgttccagaagacgttttggtgacatcaatggagacccat
caacgttactttgtggtgcgtgatcttgatggtaggcttaaaccaaactttatctcagtt
cgtaatgggaacgctgagcacttggaaaatgtcgttcgaggaaatgagaaagtcttggtg
gcgcgtctcgaagatggtgaattcttctggcgtgaagaccaaaaactcaagattgaagat
ctcgttgctaaattggcaaacgtcactttccatgaaaagattggctctctttcagaacat
atggcacgtgctggtgtcattgcggcttcattggctgagaaagcaggtttgactgctgag
gaaaaggcagcagtagcgcgtgcagcagaaatctacaaatttgacctcttgactggtatg
gttggtgagtttgatgagcttcaagggattatgggtgaaaaatatgccctccttgctggt
gaagatgaggcagtagcgacagctatccgtgagcactaccttcctgattcagcagacgga
gcccttcctgaaacgaaagttggtgctatccttgcccttgcggataaattggataccctc
ctttccttcttctcagtcggtttgattccatcaggttccaatgacccttatgcacttcgc
cgtgcaacacaaggaattgttcgtatcttggatgcctttggttggcacattcctatggat
gagttgattgacagtctttacggactttcatttgatagtctctcatatgacaatcaagca
gaagttattagatttatcaaggcccgtgtggacaagatgatgggtagcacaccaaaagat
atcaaagaagctgttctttctggttcaaactttgtagtagcagatatgcttgaagcagct
gaagctctttcagaagctgctaagacggatggttacaaggcagctgttgagtcactctct
cgtgccttcaacttggcagaaaaagcagatacttcagtagcagtcgatgctagtctcttt
gaaaatgatcaagaaaaagccttggctcaagcagcagaaagtcttgaattgacaggttca
gctagcgacaaattggctcaactctttgttcttagcccagtcattgatgctttctttgac
aatacgatggttatggcagatgatgtggctgttaaaaataaccgtttggctcttctttct
gctcttgtggctaaagctaaaactgttgcagcctttaaccaattgaatacaaaatag

DBGET integrated database retrieval system