KEGG   Streptococcus thermophilus ASCC 1275: T303_05160Help
Entry
T303_05160        CDS       T03360                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sthe  Streptococcus thermophilus ASCC 1275
Pathway
sthe00670  One carbon pool by folate
sthe01100  Metabolic pathways
sthe01120  Microbial metabolism in diverse environments
sthe01200  Carbon metabolism
Module
sthe_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sthe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    T303_05160
Enzymes [BR:sthe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     T303_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: AIC24303
Position
942093..943763
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSVELKPITEVVEKVGIGFDDLELYGKYKAKLSFDKINEVKDDKPGKLILVT
AINPTPAGEGKSTMSIGLADALNKIGKKTMIALREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALLDNHIHQGNALGIDQRRIIWKRVVDLNDRALRHVTVG
LGGPLNGIPREDGFDITVASEIMAILCLATDINDLKERLANIVVAYRYDRTPVYVRDLEI
EGALTLILKDAIKPNLVQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLDIKTPNLPTTPDAVVIVATLRALKMHGGVAKTDLSEENVQAVRDGFSNL
KRHVENIRKFGIPAVVAINEFVADTEAEIAALKELCSEIKVPVELASVWANGADGGIDLA
NTVVDAVENGNADYKRLYSDDDSLEEKITKIVTEIYGGKSVVFEKKAKNQLKQFAEFGWD
KLPVCMAKTQYSFSDNQFLLGAPEGFDITIREFVPKTGAGFIVALTGDVMTMPGLPKAPA
ALKMDVTEDGTAVGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgctcaaagtgtagaattaaaaccaatcacagaagtagtt
gaaaaagttggaatcggctttgacgatttggaactctacggaaaatataaggcaaaattg
tcatttgataaaatcaatgaagtcaaagacgacaaaccaggaaaattgattttggtaaca
gccatcaatccaacaccagcaggtgaaggtaaatcaaccatgtcaattggtcttgcagac
gctcttaacaaaattggtaagaaaacaatgattgcccttcgtgaaccatctcttggtcct
gttatggggattaaaggtggtgctgcaggtggtggttacgctcaagttcttccaatggag
gatatcaatcttcacttcacaggtgatatgcacgctattactacagcgaataatgccttg
tcagcccttcttgacaatcatattcatcaaggaaacgccctaggtattgatcaacgtcgt
attatttggaaacgtgtcgttgaccttaatgaccgtgctcttcgtcatgtgacagttggt
cttggtggcccactcaatggtatcccccgtgaagatggttttgatattaccgtagcctct
gaaatcatggcaattctttgcttggctactgacatcaacgaccttaaagaacgcttagct
aacattgtcgttgcttaccgttatgaccgtacacctgtttatgtacgtgatcttgaaatc
gaaggtgcgcttacacttattctaaaagatgccatcaaacctaacttggtacagacaatt
tatggtacaccagccttggtacatggtggtccatttgccaacatcgctcacggatgtaac
tcagttctagctacatctacagcacttcgcttggcagactacacggtcactgaagcaggt
ttcggtgcagaccttggtgctgaaaaattccttgatattaaaactccaaacctaccaaca
actccagatgctgtcgttattgttgctacacttcgtgctcttaagatgcatggtggtgtc
gctaaaactgacctttctgaggaaaatgttcaagccgttcgcgatggcttttcaaactta
aaacgtcatgtagaaaatatacgtaaatttggtattccagcggttgttgccattaacgaa
tttgttgctgacacagaagctgaaatcgcagctcttaaagaactttgttcagaaatcaag
gttcctgttgaattggctagcgtttgggctaatggtgctgatggtggtattgaccttgct
aatacagtagtggatgctgttgaaaatggcaatgctgattacaaacgtctctattcggat
gatgatagcttggaagaaaagattactaagattgttactgaaatctatggtggtaaatca
gttgtcttcgagaaaaaagctaaaaatcaactcaaacagtttgcagaatttggttgggat
aaattgccagtatgtatggctaaaacacaatatagtttctcagataaccaattcttgctt
ggagcaccagaaggttttgatatcactattcgtgagtttgttcctaaaacaggtgctgga
ttcatcgtggctctcacaggtgatgttatgaccatgccaggtcttccaaaagccccagcg
gccctcaagatggatgttactgaagatggaacagcagttggtttgttctaa

DBGET integrated database retrieval system