KEGG   Streptococcus thermophilus ASCC 1275: T303_07275Help
Entry
T303_07275        CDS       T03360                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sthe  Streptococcus thermophilus ASCC 1275
Pathway
sthe00020  Citrate cycle (TCA cycle)
sthe00480  Glutathione metabolism
sthe01100  Metabolic pathways
sthe01110  Biosynthesis of secondary metabolites
sthe01120  Microbial metabolism in diverse environments
sthe01130  Biosynthesis of antibiotics
sthe01200  Carbon metabolism
sthe01210  2-Oxocarboxylic acid metabolism
sthe01230  Biosynthesis of amino acids
Module
sthe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T303_07275
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    T303_07275
Enzymes [BR:sthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     T303_07275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIC24647
Position
complement(1337665..1338840)
Genome map
AA seq 391 aa AA seqDB search
MAERILMTNGKLKVTDNPIIPFIEGDGVGRDIWKNAQAIFDKAVEVSYGGQRRIEWQELL
AGKKAFDKTGEWLPQETLEAIRESLVAIKGPLETPVGGGIRSLNVALRQELDLYACVRPV
RYFEGVASPLKEPEKTDITIFRENTEDIYAGIEWEAGTVDVERVIAFFQTEMNVDKIRFP
KSSSIGIKPISIEGSKRLIRSAIDYALKNNLKKVTLVHKGNIQKFTEGGFRKWGYEVAEE
EYKEEMLAGRLEVNDIIADNFLQQILLNPEKFDVVALTNLNGDYASDALAAQVGGIGISP
GANINYQTGHAIFEATHGTAPDIADQDRANPCSILLSGCMLLEYIGWSEAAELIISAIEK
NFKSGIFTADLAFGKRAYSTSGFSNQIISII
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagaatccttatgactaatggcaagctcaaagttactgataatccgattatt
cctttcattgaaggagatggtgttggacgtgatatttggaagaatgctcaagcaattttt
gataaagcggtagaagtatcctatggaggacagcgtcgtattgagtggcaagagcttttg
gcaggtaaaaaggcttttgataaaacaggtgagtggttgccgcaagaaactttagaggct
attcgagaaagcctggtagctattaaggggccacttgaaacacctgtcggaggaggaatt
cgttctttaaatgtagctttacgtcaagaacttgatctctacgcttgtgttcgaccggtt
cggtatttcgaaggagtagcaagtccgcttaaggaaccagaaaaaacagacattactatt
tttcgtgagaatactgaggatatttatgcaggaattgaatgggaagcaggaacagtagat
gtagagcgcgttattgctttttttcaaacagaaatgaatgtcgataaaattcgctttccc
aagtcaagtagtattggaattaagcctatttcaatagaaggaagtaaacgattgattcgt
tcagctattgactatgctcttaagaacaatctaaagaaagtgacattggtgcataaaggg
aatattcaaaaattcacagaaggtggctttcgtaaatggggctatgaagtggctgaggaa
gaatataaggaagaaatgcttgctggccgtctagaagttaatgatataatcgctgataat
tttctacaacagattcttttgaatcccgaaaaatttgatgttgttgcattaaccaacttg
aatggcgattatgcaagtgatgctctagctgcccaggttggtggtatcggaatctcccct
ggagctaatattaactatcaaacaggccatgctatctttgaagctactcatggaacggct
ccagatattgcggatcaagatagggctaatccttgctctattctcttatctggctgtatg
cttttagaatatatcggttggtctgaagcagctgaactcattataagtgctattgaaaaa
aactttaaatcagggatttttacagctgacctagcctttggaaaacgagcctattcaacc
agtggtttcagcaatcaaattatctcaattatatga

DBGET integrated database retrieval system