KEGG   Sulfobacillus thermotolerans: BXT84_01450Help
Entry
BXT84_01450       CDS       T06144                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sthr  Sulfobacillus thermotolerans
Pathway
sthr00450  Selenocompound metabolism
sthr00970  Aminoacyl-tRNA biosynthesis
sthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sthr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BXT84_01450
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BXT84_01450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sthr01007]
    BXT84_01450
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sthr03016]
    BXT84_01450
Enzymes [BR:sthr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BXT84_01450
Amino acid related enzymes [BR:sthr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BXT84_01450
Transfer RNA biogenesis [BR:sthr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BXT84_01450
 Prokaryotic type
   Other AARSs
    BXT84_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: AUW92783
UniProt: A0A3S6Z3E8
Position
260873..262780
Genome map
AA seq 635 aa AA seqDB search
MTNKNTWYITTPIYYPSDNLHIGHAYTTVAADALARFHRLKGEPVWFVTGTDEHGQKIAQ
KAQEAQVSPKQFVDKIVHFIQDPLWRSLGISYNRFIRTTDPDHYQVVQQIFLTLQERGDI
YKGEYEGWYCLPDETFWTESKLVDGKCPDCGRPVERVKQSSYFFRMSRYQDRMIQHILDH
PDFIQPASRRNEMLSFLEAGLEDLSISRTGLAWGIPVPNDPDHVIYVWFDALSNYLTAAG
YLTDPERFSQIWPPDVQIVGKEIVRFHTIIWPIMLMALNLPLPQRVFGHGWLLIGDTKMS
KSRGNAVDPIVLSQTYGVDAVRYFLLREVPFGADGSYTEDALRLRFNVDLANDLGNLLSR
TTAMIERFSNGVIPQPHAFGPEDKRLGQIAAEIYEQVDKAMHQLLISDALSQIYRLVHAA
NKYIEERAPWSLAKDPARKEELENVLYNLAESLRVVSVLLTPFLIETPQKIRAQLGVDQP
VESYREAIYGGFQGGERIRRGDPLFPRLDLREETGAEVKLPAEVPASEEFITLEDFQKIQ
LRVGTVRQAEPVKGADRLLKLTVFDGERERTIVSGIKAYYEPEALIGQQVVLVANLKPVK
LRGILSEGMLLAGSQGQQLSIVSPARPLPEGARVK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacgaataagaatacctggtatatcacgacgcccatttactatccgagcgataatctg
catattgggcatgcctacacaaccgtggcagccgatgcgttggcacggtttcaccgtctt
aaaggggaacctgtgtggtttgtaacgggcacagatgagcacgggcaaaagattgcgcaa
aaggctcaagaggcccaggtgagtccgaagcaatttgttgacaagattgttcatttcatt
caagaccccttatggcgttctttgggtatttcttacaatcgttttattcggaccactgac
cccgaccattatcaggtcgtgcagcaaattttcttgacgctgcaagagcggggggacatt
tataagggcgaatatgagggctggtattgcttgcccgacgaaacattttggacagaatcc
aagttggtggatggaaagtgccccgactgtggacggcctgtggagcgcgtcaaacaatcc
agttacttcttccggatgagccgataccaagatcgcatgattcagcacatattggaccat
cccgactttatccagcctgctagccgacgtaacgaaatgttgagttttttggaggcggga
ttggaagatttgtcgatatcgcgcacgggtctcgcgtgggggattccggtgcccaacgac
ccggatcatgtgatttacgtgtggtttgatgcactgtctaactatttgacggctgccggc
tacctcaccgatccggaacggtttagccagatttggccgccagatgtgcaaattgtggga
aaggaaattgttcgcttccacaccattatttggcccatcatgctaatggcgttaaatctt
cccctcccgcagcgggtgtttggccatggctggcttttgattggtgataccaagatgtca
aagtctcgtggcaatgcggtcgatcccattgtgttgagccagacctacggcgtggatgcc
gtgcgctattttcttctccgggaagtcccgtttggtgccgacggtagctataccgaagat
gctttacggctgcggtttaatgtcgacttggccaatgacctaggcaatcttttaagccgt
accacggcaatgattgaacgattttccaatggggtaattccccagccccatgcctttggc
cctgaggacaaacggcttggtcaaatcgccgcggaaatttatgagcaggtcgacaaggca
atgcatcagctcttgatttcggacgctttaagtcagatttaccgtttggtgcacgccgct
aataagtatattgaggaacgggcgccgtggagtttggcgaaagatccggcacgaaaagag
gagctggagaatgttttatataatttggccgagtcgttgcgtgtggtgtcagtcctgttg
accccattcctgattgagacgcctcagaaaatccgtgcgcagctaggggtagaccagccc
gtggaatcctaccgggaagcgatttatggcggatttcaagggggcgagcgcattcgccga
ggggatccgctgtttccccgcttggatttgcgcgaagagaccggagcagaggttaagctg
ccggctgaggttccggcgtctgaggagttcattacgttggaagacttccagaagatccag
ctgcgcgtaggcactgttcgtcaggcagaacccgtaaaaggcgccgatcgcttgctgaag
ttgaccgtgtttgatggcgagcgcgaacggaccattgtatcgggcattaaagcctattat
gagcccgaagcgttaattgggcagcaagtggtcttggtggcgaatctcaagccggtgaaa
ttgcgtgggattttaagtgaaggcatgctgttagcgggatctcagggtcagcagttaagc
attgtcagtcccgccaggccgttgccggaaggagcgcgcgtaaagtga

DBGET integrated database retrieval system