KEGG   Sulfobacillus thermotolerans: BXT84_13530Help
Entry
BXT84_13530       CDS       T06144                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sthr  Sulfobacillus thermotolerans
Pathway
sthr00030  Pentose phosphate pathway
sthr00480  Glutathione metabolism
sthr01100  Metabolic pathways
sthr01110  Biosynthesis of secondary metabolites
sthr01120  Microbial metabolism in diverse environments
sthr01130  Biosynthesis of antibiotics
sthr01200  Carbon metabolism
Module
sthr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BXT84_13530
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BXT84_13530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sthr04147]
    BXT84_13530
Enzymes [BR:sthr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BXT84_13530
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BXT84_13530
Exosome [BR:sthr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BXT84_13530
  Exosomal proteins of colorectal cancer cells
   BXT84_13530
  Exosomal proteins of bladder cancer cells
   BXT84_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AUW94845
UniProt: A0A3S6Z7K7
Position
complement(2747970..2749379)
Genome map
AA seq 469 aa AA seqDB search
MTDHSTFVIFGATGDLTRRLLFPAIYRLYAQGEWAPTRIIAYAKEDWSASQFLTHVENNL
KSFAPTFDANTWERLKASVTYRSGDLQAHDLKQLAPDITGPAVFYLALPPQLFAQAAKGL
GEAGFNDQTNGWRRLVVEKPFGLDLESAQTLGNAIAAWWAEDQIFRIDHFLGKDTAQNVL
VFRFVNRLLESVWNGAHIAQVQITYAETLGLEGRWQYYDKAGALRDMLQNHLLQLFALVA
MEPPSGWAAEELHNHKAEVLRAVRALEADSAVAGQYGPGTTQGQAVPGYVQENGIAADSQ
TETYAALKLHVDNWRWHGVPFYLRSGKRLAADYAEIAIQLKPVPRHLFGAGLADWIVFRM
KPDEAIDLVMFAKKPGLEMDTKQVILSAPYKKAGEHDYSAYEQLLLDVLSGEQSAFPRWD
EVEQSWRIVDPILKAWANTPPEVYPAGSQGPRSQDRLMEAGLQWRPLPS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccatagcacctttgttatttttggagccacaggcgatttaacccgtcgactt
ttgtttccagccatttaccgtttatacgcccaaggtgaatgggcgcctacgcggattatt
gcctatgcgaaagaagattggagtgcttcgcagtttttgacgcatgttgaaaacaacctc
aagtcttttgcgccgacttttgatgcgaacacttgggaacgcttgaaagcttccgtaacg
tatcgttccggcgatctgcaggctcacgatctaaagcagttggctccagatattaccgga
cctgccgtgttttatctggcattgccaccgcaactgtttgctcaagccgcaaagggcctg
ggagaggcagggttcaatgatcaaacgaatgggtggcgacggctggtcgtagaaaagccg
tttggtttggatctggaatcggcccaaacgttagggaacgccattgccgcgtggtgggca
gaagatcagatctttcgcattgaccattttctcggtaaggatacggcgcaaaatgttctt
gtctttcgttttgtcaatcgattattggaatccgtctggaatggggctcatattgcgcaa
gtgcagattacctatgcggaaacattagggctagaaggacgctggcagtactatgacaag
gcgggtgccttgcgggatatgttgcaaaatcatttgttgcagcttttcgcactggtcgcc
atggaaccgccgagtggatgggcagcagaggagctccataatcacaaggcggaagtattg
cgggctgtgcgcgctctggaagcggacagtgcggtggcaggtcaatatgggccgggaacg
actcagggccaggccgttcctgggtatgttcaagaaaacggaattgccgcagattcccag
acggaaacgtatgcggcattgaaactccatgtcgataactggcgatggcatggcgttcca
ttttatttgcgaagcggtaagcggctggctgcagattacgctgaaattgcgattcagctc
aaacccgttccgcgccacttatttggggcgggcctagcggattggatcgtctttcggatg
aaacccgatgaagctattgacctcgtgatgtttgcgaaaaaacccggcctggaaatggat
accaaacaggtgattttgagcgcgccgtataaaaaggctggagagcatgattattcggcg
tatgaacaattgctcttagatgtgctcagtggggaacaaagcgcctttccgcggtgggac
gaagttgagcagtcatggcggattgtggaccctattttgaaagcgtgggccaatacccca
ccagaagtttaccccgctggcagccaaggaccacgcagccaggatcgattgatggaggcc
ggattgcagtggcgtccactgccatcataa

DBGET integrated database retrieval system