KEGG   Streptococcus thermophilus S9: AVT04_01140Help
Entry
AVT04_01140       CDS       T04785                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00473  D-Alanine metabolism
sths01100  Metabolic pathways
sths01503  Cationic antimicrobial peptide (CAMP) resistance
sths02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sths00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AVT04_01140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVT04_01140
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AVT04_01140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sths01504]
    AVT04_01140
Enzymes [BR:sths01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     AVT04_01140
Antimicrobial resistance genes [BR:sths01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    AVT04_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ALX90552
Position
complement(212892..214442)
Genome map
AA seq 516 aa AA seqDB search
MTSTKIKDMIETIEQFAQSQPDFPVYNILGEVHTYGDLKADSDSLAAKIDSLDIPEKSPV
VVYGGQEYEMLATFVALTKSGHAYIPIDSHSALERVIAIVEVAEPSLIIAINAFPLEDVK
APILTLDQVKESFANKTTYKVTHPVKGDDTYYIIFTSGTTGKPKGVQISHNNLLSFTNWM
ITDKEFATPKRPQMLAQPPYSFDLSVMYWAPTLALGGTLYALPSAITQDFKQLFETIFSL
PIAIWTSTPSFADMAMLSEDFNAEKMPEITHFYFDGEELTVKTAQKLRQRFPEARIVNAY
GPTEATVALSAVSVTDEMLATLNRLPIGYTKEDSPTYIIDEDGNILPNGQQGEIIVSGPA
VSKGYMNNPEKTAEAFFEFNGLPAYHTGDVGTMTDEGLLLYSGRMDFQIKFNGFRIELED
VSQNLNKSKYIDSAVAVPRYNKDHKVQNLLAYVILKDGVRDQFERDIDITKAIKADLEDI
MMSYMMPTKFLYRESLPLTPNGKIDIKGLISEVNNR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtacaaaaattaaagatatgattgaaacgattgagcagtttgctcaatcacaa
cccgactttcctgtttacaatattttaggggaagtccatacttacggcgatttgaaagcc
gattcggatagtttagctgctaagattgatagccttgatatcccagaaaaatcacctgtt
gtagtttatggcggtcaagaatatgaaatgttggcaactttcgtagctttaactaaatct
ggtcacgcctatataccaattgatagtcactcagctcttgagcgcgtgatagctattgtt
gaagtggcagagccgagtctgattattgctattaacgccttcccactagaggatgttaaa
gcaccaatcttgacattggatcaagtgaaggaaagttttgctaacaagactacttataaa
gtaacccaccctgttaaaggtgatgatacttattacatcatcttcacatcagggactaca
ggtaaacctaaaggagttcagatttcgcataataaccttcttagtttcaccaactggatg
attacagacaaggaatttgcgactccaaaacgtcctcaaatgttggctcaaccgccttat
tcatttgacctatcagtaatgtactgggcgccaactttggcacttggaggaacactctat
gcgcttccttcagctattactcaggacttcaagcaactatttgaaactatcttttcactt
ccaattgccatttggacatccacgccatcatttgcagatatggcaatgttgtctgaagac
ttcaatgcagagaagatgccagaaattacgcatttctatttcgatggggaagagttgact
gtcaagactgctcagaaactccgccaacgtttcccagaagcacgtattgtcaatgcttat
ggaccaactgaggctactgttgccttgtcagcagtatcggtaactgatgagatgctagct
actcttaatcgtctaccgattggttataccaaggaagattcaccaacttatattatcgat
gaagacggtaatatccttccaaatggtcagcagggtgaaattatcgtatcgggtcctgca
gtttcaaaaggttatatgaataatcctgaaaagactgcggaagccttcttcgagtttaat
ggtctacctgcttaccatactggtgatgtgggtactatgactgatgagggtctccttctt
tacagtggtcgtatggactttcagattaaatttaatggtttccgtattgagttagaagat
gtttcccaaaaccttaataagtctaagtatatcgattcagcagtagctgtcccacgttat
aacaaagaccataaggttcagaacctcttggcttatgtgattcttaaggatggcgtacgt
gaccagtttgagcgtgacatcgatattactaaggctatcaaagctgacttggaagatatc
atgatgtcatacatgatgcctactaagttcctctatcgtgagagcttgcctcttacacca
aatgggaaaattgatatcaagggtcttatcagtgaggttaataaccgatga

DBGET integrated database retrieval system