KEGG   Streptococcus thermophilus S9: AVT04_05880Help
Entry
AVT04_05880       CDS       T04785                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
sths  Streptococcus thermophilus S9
Brite
KEGG Orthology (KO) [BR:sths00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sths03009]
    AVT04_05880
Enzymes [BR:sths01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AVT04_05880
Ribosome biogenesis [BR:sths03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AVT04_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS CMAS Methyltransf_32 Ubie_methyltran zf-Sec23_Sec24
Motif
Other DBs
NCBI-ProteinID: ALX91340
Position
1083198..1084031
Genome map
AA seq 277 aa AA seqDB search
MANFSVFKNQESLFACPICQASMHLEQSSLVCQNRHTFNIAKQGFVNFLRQNKGDKHYDM
ASFENRSQILAAGYYDSILEVISERLRDLPRHSHVLDVACGEGYYSRQLALAFDKDFMAF
DLSKDSILLAARQNPQKNVAWFVGDLAKLPLREHSIDLILDIFSPANYQEFGRLLTDQGL
IFKVIPHEDHLKEFRQLLPEVHAYSNQDVVEHFQESCELLERVTIVRTWSMPPEHVQTFA
EMTPLFFHVDKNGLNLSSVTQLTVAGELLIGRIKNDK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaattttagtgtttttaaaaatcaagaaagcctttttgcttgtcctatttgtcag
gcttcaatgcatttggaacagtctagcttggtttgtcagaataggcatacctttaatatc
gccaagcagggctttgtcaattttttgagacagaacaagggagataaacactatgatatg
gcttcttttgaaaataggagtcagattcttgcggcaggctactatgattccatcctggag
gtgatttccgagcgtttgcgtgaccttcctagacattcgcatgttctagatgttgcctgt
ggtgagggctattacagccgtcagttggctttagcatttgacaaagatttcatggccttt
gatttgtctaaggactccatccttcttgcggctcgtcaaaatcctcagaaaaatgtggca
tggttcgttggtgatttggctaaactgcccttgcgtgagcacagtatagacctgatttta
gatatcttttcaccagctaattatcaagaatttggacgacttttgactgatcaggggttg
attttcaaggttattcctcatgaagatcatcttaaagagtttcgccaactattaccggag
gtgcatgcttactctaatcaggatgttgtggaacatttccaggaatcctgtgaacttttg
gagcgtgtgactattgtcaggacttggtctatgccaccagaacatgttcaaacatttgca
gagatgacacctcttttcttccatgttgataagaacggtttaaatttgtcctcggtgacg
caattgacagttgcaggagagttactgattggtcgtattaaaaatgataagtaa

DBGET integrated database retrieval system